(data stored in ACNUC7421 zone)

EMBL: CP001825.PE274

CP001825.PE274       Location/Qualifiers
FT   CDS             294524..297415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0276"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41198"
FT                   /db_xref="GOA:D1CE42"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE42"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACZ41198.1"
FT                   /translation="MYWLLNLLGIVKIAFLRQKSYLGLVLALLAGFIVAITLVVSIPLY
FT                   ADAVGYRILRTELLEEQEGNLRPPFSYMFMAVASNEQRVPISGFRSADEYFTKYGARDL
FT                   GLPPLVYVRYVTTDKIRLLAPEGTAYKEEKGEEQLEWVSVGFASGLEKKVRIVEGRWPK
FT                   IASNDSNSPVEVLVHEGLADKLGLHVGENYIVMEKGVGDNLLRLPIKISGIWEPIDPSD
FT                   SYWFIRPQSLQDVLMVPEQTFSQRILRTHPNDGIYMALWYYVLDGTSVRSRHAQELIGR
FT                   MQGVERHAATLLPAVELRVSPEDALTEQHTQVRFLTLSLIVFSIPILGLIAYFIIMITS
FT                   MAVQRQQNEIAVLRSRGISRSGILGIFLLESLGLGILALVLGLGLGQYTALAMGWTRSF
FT                   LDFIPRYDFPVELSPESIRAGTWVMVLTLIASVVPAVGAAGHTIISYKRERARSLGAPF
FT                   WQKIYLDILLLIPAWYGYQQLKQRGTISFLGEGLPSDDPFKNPLLILTPVLWLLALGLL
FT                   SMRILPIVLGFIAQLIGRLKGISSVMALRYLTRTPRAYSGPVMLIVLTLSLATFTASMA
FT                   KTLDRHTYDRVYYDIGADMRLADLGQSTEPSSAGPGGGSSQQQPEQQDEGTPKWLFLPV
FT                   TEYLKVPGVENAMRVTRSDTEAVVGNSRQRGTLLGIDRMEFPKIAYWRDDYATYPLGYL
FT                   MNALGTFEDGLLVSRDFMREQGLSIGSKITLNLWDVEESKPVPFTIVGELNYFPTLYPE
FT                   DGPFFVGNIDYIFQREGGEFPYEVWLKVKPGTTKEQIELSTTKLGFRSIVTDVAQPEIE
FT                   SDQGRPERQGLYGLLSVGFLASAILTGLGFLFYSIVSFRRRFVELGTLRAIGLSTGQMA
FT                   AMLACEQLIIIGLSVVIGTVLGVLVSDMFIPFLQVSTGEHPQTPPFLVLIAWDRLMLIY
FT                   LIFAVLLGLALVMLAMLLLRMKIFQAVKLGESV"
     MYWLLNLLGI VKIAFLRQKS YLGLVLALLA GFIVAITLVV SIPLYADAVG YRILRTELLE        60
     EQEGNLRPPF SYMFMAVASN EQRVPISGFR SADEYFTKYG ARDLGLPPLV YVRYVTTDKI       120
     RLLAPEGTAY KEEKGEEQLE WVSVGFASGL EKKVRIVEGR WPKIASNDSN SPVEVLVHEG       180
     LADKLGLHVG ENYIVMEKGV GDNLLRLPIK ISGIWEPIDP SDSYWFIRPQ SLQDVLMVPE       240
     QTFSQRILRT HPNDGIYMAL WYYVLDGTSV RSRHAQELIG RMQGVERHAA TLLPAVELRV       300
     SPEDALTEQH TQVRFLTLSL IVFSIPILGL IAYFIIMITS MAVQRQQNEI AVLRSRGISR       360
     SGILGIFLLE SLGLGILALV LGLGLGQYTA LAMGWTRSFL DFIPRYDFPV ELSPESIRAG       420
     TWVMVLTLIA SVVPAVGAAG HTIISYKRER ARSLGAPFWQ KIYLDILLLI PAWYGYQQLK       480
     QRGTISFLGE GLPSDDPFKN PLLILTPVLW LLALGLLSMR ILPIVLGFIA QLIGRLKGIS       540
     SVMALRYLTR TPRAYSGPVM LIVLTLSLAT FTASMAKTLD RHTYDRVYYD IGADMRLADL       600
     GQSTEPSSAG PGGGSSQQQP EQQDEGTPKW LFLPVTEYLK VPGVENAMRV TRSDTEAVVG       660
     NSRQRGTLLG IDRMEFPKIA YWRDDYATYP LGYLMNALGT FEDGLLVSRD FMREQGLSIG       720
     SKITLNLWDV EESKPVPFTI VGELNYFPTL YPEDGPFFVG NIDYIFQREG GEFPYEVWLK       780
     VKPGTTKEQI ELSTTKLGFR SIVTDVAQPE IESDQGRPER QGLYGLLSVG FLASAILTGL       840
     GFLFYSIVSF RRRFVELGTL RAIGLSTGQM AAMLACEQLI IIGLSVVIGT VLGVLVSDMF       900
     IPFLQVSTGE HPQTPPFLVL IAWDRLMLIY LIFAVLLGLA LVMLAMLLLR MKIFQAVKLG       960
     ESV                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page