(data stored in ACNUC7421 zone)

EMBL: CP001825.PE275

CP001825.PE275       Location/Qualifiers
FT   CDS             297412..298416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0277"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccs:CCNA_02006 lipoprotein releasing system
FT                   ATP-binding protein LolD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41199"
FT                   /db_xref="GOA:D1CE43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE43"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41199.1"
FT                   /translation="MSEPIIICENLVKIYKLAQVEVLALQGLDLTVERGEVMALVGPSG
FT                   SGKTSLMNVIGGLDRPTAGRVVVAGQELLKLSDRQLNHYRRHVVGFVWQQVARNLVPYL
FT                   NAEQNVELPMLMAGIKPAERKAWANELLEVVGLGNRKKHKLAQLSGGEQQRVAIAVALA
FT                   NKPQLLLADEPTGELDSATAKTIFDIFHKLNEMYGITVVIVSHDPQISRHVSRTVAIRD
FT                   GKTSTETLRQVVETEKEDEAKEEQHHFIEYTVLDPAGRLQVPEEYRELYRIGRRVILET
FT                   LPDGIVIRPVPGEEVTTVQPLVDEDEPPPKKQNLVSRIRKFLPMGSKGESEQK"
     MSEPIIICEN LVKIYKLAQV EVLALQGLDL TVERGEVMAL VGPSGSGKTS LMNVIGGLDR        60
     PTAGRVVVAG QELLKLSDRQ LNHYRRHVVG FVWQQVARNL VPYLNAEQNV ELPMLMAGIK       120
     PAERKAWANE LLEVVGLGNR KKHKLAQLSG GEQQRVAIAV ALANKPQLLL ADEPTGELDS       180
     ATAKTIFDIF HKLNEMYGIT VVIVSHDPQI SRHVSRTVAI RDGKTSTETL RQVVETEKED       240
     EAKEEQHHFI EYTVLDPAGR LQVPEEYREL YRIGRRVILE TLPDGIVIRP VPGEEVTTVQ       300
     PLVDEDEPPP KKQNLVSRIR KFLPMGSKGE SEQK                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page