(data stored in ACNUC7421 zone)

EMBL: CP001825.PE279

CP001825.PE279       Location/Qualifiers
FT   CDS             complement(300102..300905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0281"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   acp:A2cp1_3352 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41203"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE47"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACZ41203.1"
FT                   /translation="MSNFPDTPDKNTPCQVTLRFYAELNDFLPADKRQQDWLIDLDRRT
FT                   SIKDLVESLGVPHTEVDLLVANGDIIDFSYVPKCGDRISVYPEFRSLSLGHHLKPDLDP
FT                   NPKFVLDAHLGKLAGYLRMLGFDTIYDPDSSDLDLAFASKADGRILLTRDIGLLKRKIV
FT                   FRGYYVRETEPKRQIIEVIKQFKLLDKINPFGRCAHCNDLLIDVPKREIIHLLLPKTIL
FT                   YYDEFRRCRGCGKIYWKGSHHEAILRLIESIQEEVSLEPKRLQTS"
     MSNFPDTPDK NTPCQVTLRF YAELNDFLPA DKRQQDWLID LDRRTSIKDL VESLGVPHTE        60
     VDLLVANGDI IDFSYVPKCG DRISVYPEFR SLSLGHHLKP DLDPNPKFVL DAHLGKLAGY       120
     LRMLGFDTIY DPDSSDLDLA FASKADGRIL LTRDIGLLKR KIVFRGYYVR ETEPKRQIIE       180
     VIKQFKLLDK INPFGRCAHC NDLLIDVPKR EIIHLLLPKT ILYYDEFRRC RGCGKIYWKG       240
     SHHEAILRLI ESIQEEVSLE PKRLQTS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page