(data stored in ACNUC7421 zone)

EMBL: CP001825.PE283

CP001825.PE283       Location/Qualifiers
FT   CDS             complement(305809..307101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0285"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: dal:Dalk_2855
FT                   glutamate-1-semialdehyde-2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41207"
FT                   /db_xref="GOA:D1CE51"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE51"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ACZ41207.1"
FT                   /translation="MKILANNSSKLFQRAQKVMPGGVSSPVRAFRAVGGEPIFIDKAQG
FT                   SRLFDVDGKEYIDFVGSWGPMILGHAHPEVLRLIHEAVDKGTSFGAPNQYELQLAEMVT
FT                   SLVPSVDVVRFVNSGTEATMSAVRLARAVTSRDLVVKFDGCYHGHADFFLVAAGSGAMT
FT                   LGQPDSLGVPNQIASLTASLPYNDIEHVTTFFQERGNEIAAVIVEPVAGNMGVVLPKQD
FT                   FLAKLRELTSKYGALLIFDEVITGFRLSLGGAQQLFDIKPDITTLGKIIGGGLPVGAYG
FT                   GTAEIMNMLAPNGPVYQAGTLSGNPIAMAAGYKTIHILQQDEGVYERLDYMGSYLEKGL
FT                   QDAAKDAGVGVTINRAGSMLTIFFSSYPVSNYQDAKRSDTTMFAKFHSNMLAQGIYLPP
FT                   SQFEAWFLSTAHTREDLDRTIEAAYTALKKI"
     MKILANNSSK LFQRAQKVMP GGVSSPVRAF RAVGGEPIFI DKAQGSRLFD VDGKEYIDFV        60
     GSWGPMILGH AHPEVLRLIH EAVDKGTSFG APNQYELQLA EMVTSLVPSV DVVRFVNSGT       120
     EATMSAVRLA RAVTSRDLVV KFDGCYHGHA DFFLVAAGSG AMTLGQPDSL GVPNQIASLT       180
     ASLPYNDIEH VTTFFQERGN EIAAVIVEPV AGNMGVVLPK QDFLAKLREL TSKYGALLIF       240
     DEVITGFRLS LGGAQQLFDI KPDITTLGKI IGGGLPVGAY GGTAEIMNML APNGPVYQAG       300
     TLSGNPIAMA AGYKTIHILQ QDEGVYERLD YMGSYLEKGL QDAAKDAGVG VTINRAGSML       360
     TIFFSSYPVS NYQDAKRSDT TMFAKFHSNM LAQGIYLPPS QFEAWFLSTA HTREDLDRTI       420
     EAAYTALKKI                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page