(data stored in ACNUC7421 zone)

EMBL: CP001825.PE284

CP001825.PE284       Location/Qualifiers
FT   CDS             complement(307082..308341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0286"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: pca:Pcar_3064 glutamyl-tRNA reductase;
FT                   TIGRFAM: glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41208"
FT                   /db_xref="GOA:D1CE52"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE52"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ACZ41208.1"
FT                   /translation="MSGIFLTGINHTTANADIRERLYLSDPDIATLLAKLNQRFEEAVV
FT                   LSTCNRLEIYIYDSSPDHRYVVSCISSLVNAPEEQITSHSYTKSDREAVYHLMSVAAGL
FT                   DSVVLGESQILGQVRQAWEKAASLDTTGPVLNTLFRYALQAGKDVRTKVPIGRGATSVA
FT                   HAAVELTRSRFGSLRDLCVVVLGAGEMGRLAARNLRSAGVKRITIINRTYERAKFLAED
FT                   IGGEAVPIEDMDLALASADVLITCSLSPRPLVLTSHLEHAVRYKQDRQLLVIDIAIPRN
FT                   VDPQVRSLPSVSLYDMDDIQEICNRNRHARKMAARLAHKELQYWVEEFFKWQHERLAVP
FT                   LIRDVRGKAEQIRKDRLEKTFGILKDLTDEQRYVIDAMSKSIVNAILHNPTIWIKQVED
FT                   EDLKRLFADMWGVNHENPGK"
     MSGIFLTGIN HTTANADIRE RLYLSDPDIA TLLAKLNQRF EEAVVLSTCN RLEIYIYDSS        60
     PDHRYVVSCI SSLVNAPEEQ ITSHSYTKSD REAVYHLMSV AAGLDSVVLG ESQILGQVRQ       120
     AWEKAASLDT TGPVLNTLFR YALQAGKDVR TKVPIGRGAT SVAHAAVELT RSRFGSLRDL       180
     CVVVLGAGEM GRLAARNLRS AGVKRITIIN RTYERAKFLA EDIGGEAVPI EDMDLALASA       240
     DVLITCSLSP RPLVLTSHLE HAVRYKQDRQ LLVIDIAIPR NVDPQVRSLP SVSLYDMDDI       300
     QEICNRNRHA RKMAARLAHK ELQYWVEEFF KWQHERLAVP LIRDVRGKAE QIRKDRLEKT       360
     FGILKDLTDE QRYVIDAMSK SIVNAILHNP TIWIKQVEDE DLKRLFADMW GVNHENPGK        419
//

If you have problems or comments...

PBIL Back to PBIL home page