(data stored in ACNUC7421 zone)

EMBL: CP001825.PE286

CP001825.PE286       Location/Qualifiers
FT   CDS             complement(309192..310064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0288"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA- binding
FT                   domain protein; KEGG: bsu:BSU16100 succinyl-CoA synthetase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41210"
FT                   /db_xref="GOA:D1CE54"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE54"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ACZ41210.1"
FT                   /translation="MSILVDKNTRLLVQGITGREGSFHTQQMVEYGTNVVAGVTPGAAG
FT                   REVCGVPVYNTVREAVEATGANTSIVYVPAPFAPDAVYEAASAGISLIVCITEHIPAVD
FT                   EVKMYHYVREKGSRLIGPNCPGLTTPGEAKVGIIPGNIHKRGPVGIVSRSGTLTYEAVA
FT                   ALTAADIGQSTVVGIGGDPIVGTSFREVLEMFEDDPETHAVVLIGEIGGNAEEEAAEYI
FT                   RQMTKPVVAFIAGRTAPPGRRMGHAGAIISGGSGTAESKIRALEGANAHIAETPSQIAE
FT                   LVEVALAGA"
     MSILVDKNTR LLVQGITGRE GSFHTQQMVE YGTNVVAGVT PGAAGREVCG VPVYNTVREA        60
     VEATGANTSI VYVPAPFAPD AVYEAASAGI SLIVCITEHI PAVDEVKMYH YVREKGSRLI       120
     GPNCPGLTTP GEAKVGIIPG NIHKRGPVGI VSRSGTLTYE AVAALTAADI GQSTVVGIGG       180
     DPIVGTSFRE VLEMFEDDPE THAVVLIGEI GGNAEEEAAE YIRQMTKPVV AFIAGRTAPP       240
     GRRMGHAGAI ISGGSGTAES KIRALEGANA HIAETPSQIA ELVEVALAGA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page