(data stored in ACNUC7421 zone)

EMBL: CP001825.PE291

CP001825.PE291       Location/Qualifiers
FT   CDS             314406..315608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3146 WD40 domain protein beta
FT                   propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41215"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41215.1"
FT                   /translation="MVLFVFLTSCSWGTTGRNTSKQAVQPTQTSYQRGTKHPEPTNSSP
FT                   RGITPVPTVTPKAGQQQRVKRRDLVLFQSDKAIWKMDPSRGSAEVFLNLTCRELLLNPR
FT                   TQDLTCIQPSKSKSTGLLLINLETHKSKEIVSDNVIQAAWSQDGRYLAYTVTRDSNHDK
FT                   KLELYLDRSLIYIKDIVRGSTIRVGPGIDPAWDPRKPQLFFATLGSRQGNKIMSYSLAS
FT                   RAFKEVVAIKDLPKDLSQYGVPFATKLNLLRHPSISYDGSRLAISAYGSTALLITLDLH
FT                   KPDKNNIHVEDFAPESSFEHLVWGPNSHKLAYEVLTPSGLDQLAVLDVSTGNREIFGDI
FT                   RSGIGYTEPAWAPDGKHLIATRTYRNRAKGIYMITLGNQRIRTLKPGYYSKSLWIRVLT
FT                   R"
     MVLFVFLTSC SWGTTGRNTS KQAVQPTQTS YQRGTKHPEP TNSSPRGITP VPTVTPKAGQ        60
     QQRVKRRDLV LFQSDKAIWK MDPSRGSAEV FLNLTCRELL LNPRTQDLTC IQPSKSKSTG       120
     LLLINLETHK SKEIVSDNVI QAAWSQDGRY LAYTVTRDSN HDKKLELYLD RSLIYIKDIV       180
     RGSTIRVGPG IDPAWDPRKP QLFFATLGSR QGNKIMSYSL ASRAFKEVVA IKDLPKDLSQ       240
     YGVPFATKLN LLRHPSISYD GSRLAISAYG STALLITLDL HKPDKNNIHV EDFAPESSFE       300
     HLVWGPNSHK LAYEVLTPSG LDQLAVLDVS TGNREIFGDI RSGIGYTEPA WAPDGKHLIA       360
     TRTYRNRAKG IYMITLGNQR IRTLKPGYYS KSLWIRVLTR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page