(data stored in ACNUC7421 zone)

EMBL: CP001825.PE293

CP001825.PE293       Location/Qualifiers
FT   CDS             complement(316528..316872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0295"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="TIGRFAM: S-adenosylmethionine decarboxylase
FT                   proenzyme; PFAM: S-adenosylmethionine decarboxylase
FT                   related; KEGG: gdi:GDI2320 putaive S-adenosylmethionine
FT                   decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41217"
FT                   /db_xref="GOA:D1CE61"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE61"
FT                   /inference="protein motif:TFAM:TIGR03330"
FT                   /protein_id="ACZ41217.1"
FT                   /translation="MSFRHILYDLWVEDPSILERTKPLEQIMLEAARCSGATILHSYFH
FT                   QFDPHGVSGVVLIAQSHLSIHTWSEEKYAAIDVFTYQGMNPELAISYIREKLRPTRERI
FT                   TDLSRGGTLL"
     MSFRHILYDL WVEDPSILER TKPLEQIMLE AARCSGATIL HSYFHQFDPH GVSGVVLIAQ        60
     SHLSIHTWSE EKYAAIDVFT YQGMNPELAI SYIREKLRPT RERITDLSRG GTLL             114
//

If you have problems or comments...

PBIL Back to PBIL home page