(data stored in ACNUC7421 zone)

EMBL: CP001825.PE296

CP001825.PE296       Location/Qualifiers
FT   CDS             complement(318777..319460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0298"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; BAAT/Acyl-CoA
FT                   thioester hydrolase; KEGG: scl:sce0062 putative
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41220"
FT                   /db_xref="GOA:D1CE64"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE64"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ACZ41220.1"
FT                   /translation="MGEMVTFPSNGTTAEGYLAKPDTDKAPGVLVIQEWWGLNDNIKSI
FT                   CERFASEGFLALAPDLYHGRATTEPDEARKLAMSLQMETAAKDMSGAVDYLREHAGYTS
FT                   VGAVGYCMGGGLALFIAALRGDVVKAVVPFYGLVPPSAPPVDWSKLQASVLGHYAELDQ
FT                   GITVERVREFENQLKSLGKEVEIHIYQGAQHGFCNDTRPQVYNREACELAWQRTIAFLR
FT                   KKLVS"
     MGEMVTFPSN GTTAEGYLAK PDTDKAPGVL VIQEWWGLND NIKSICERFA SEGFLALAPD        60
     LYHGRATTEP DEARKLAMSL QMETAAKDMS GAVDYLREHA GYTSVGAVGY CMGGGLALFI       120
     AALRGDVVKA VVPFYGLVPP SAPPVDWSKL QASVLGHYAE LDQGITVERV REFENQLKSL       180
     GKEVEIHIYQ GAQHGFCNDT RPQVYNREAC ELAWQRTIAF LRKKLVS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page