(data stored in ACNUC7421 zone)

EMBL: CP001825.PE297

CP001825.PE297       Location/Qualifiers
FT   CDS             complement(319483..320118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0299"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   aba:Acid345_3436 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41221"
FT                   /db_xref="GOA:D1CE65"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE65"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACZ41221.1"
FT                   /translation="MEEIAPSIARYLDALVPERTGDMVIMEDYAKAHGFPIIGPSAGYF
FT                   CYLMTRVMGARKVFELGSGYGYSTAWFARGVHENGGGVVHHTVWDSNLSNMARLHLKNM
FT                   GYENIVVYHIGEAVETLRNTDDTFDIVFNDIDKSAYPDSLPVIKSKLKKGGMLIVDNIL
FT                   WHGRILDPSERSRDTEAIRVMIDMVRNDPEWIYSIVPLRDGLLLAYKQ"
     MEEIAPSIAR YLDALVPERT GDMVIMEDYA KAHGFPIIGP SAGYFCYLMT RVMGARKVFE        60
     LGSGYGYSTA WFARGVHENG GGVVHHTVWD SNLSNMARLH LKNMGYENIV VYHIGEAVET       120
     LRNTDDTFDI VFNDIDKSAY PDSLPVIKSK LKKGGMLIVD NILWHGRILD PSERSRDTEA       180
     IRVMIDMVRN DPEWIYSIVP LRDGLLLAYK Q                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page