(data stored in ACNUC7421 zone)

EMBL: CP001825.PE301

CP001825.PE301       Location/Qualifiers
FT   CDS             324891..325889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0303"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sfu:Sfum_0829 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41225"
FT                   /db_xref="GOA:D1CE69"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE69"
FT                   /inference="protein motif:TFAM:TIGR02822"
FT                   /protein_id="ACZ41225.1"
FT                   /translation="MKAQMLSEQLSIDRRPLKLVEVDEPSIGQKDLLIKVKACGVCHTD
FT                   LHIVEGDIPLHKRPIVPGHQIVGVVEKVGEAVTRFSPGDRVGVPWLNWACGRCEYCQRG
FT                   YENLCVNGKFTGWDVDGGYAEYQVTSEDFTYHIPDGYSDLQAAPLLCAGVVGYRALKLA
FT                   KADNAERVGLYGFGASAHIAIQVLRYWGTRVFVFTRSREHQKLALELGAEWAGTANDDP
FT                   GVLMQSSIIYAPAGDIIPQALGVLDKGGVLSLAGIYMTPIPQLDYELLRGEKVIVNVTN
FT                   ATRQDAIELLDLAPRVPIRTEIEVYPLEEANDVLLRLKESKINGSAVLQIS"
     MKAQMLSEQL SIDRRPLKLV EVDEPSIGQK DLLIKVKACG VCHTDLHIVE GDIPLHKRPI        60
     VPGHQIVGVV EKVGEAVTRF SPGDRVGVPW LNWACGRCEY CQRGYENLCV NGKFTGWDVD       120
     GGYAEYQVTS EDFTYHIPDG YSDLQAAPLL CAGVVGYRAL KLAKADNAER VGLYGFGASA       180
     HIAIQVLRYW GTRVFVFTRS REHQKLALEL GAEWAGTAND DPGVLMQSSI IYAPAGDIIP       240
     QALGVLDKGG VLSLAGIYMT PIPQLDYELL RGEKVIVNVT NATRQDAIEL LDLAPRVPIR       300
     TEIEVYPLEE ANDVLLRLKE SKINGSAVLQ IS                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page