(data stored in ACNUC7421 zone)

EMBL: CP001825.PE303

CP001825.PE303       Location/Qualifiers
FT   CDS             complement(326813..327670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0305"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: hch:HCH_04507 rhodanese-related
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41227"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE71"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACZ41227.1"
FT                   /translation="MSYETLISVQEAAKHLHDPNWVFIDCRYTLGDPEKGLRDYLQAHI
FT                   PGAVYAHLDKDLSGKVIPGKTGRHPLPDLIDFDKTMSRLGVSQESQVVAYDEQTGAMAA
FT                   ARLWWLLKWAGHNNVAVLDGGFRAWIANGLPVATGKESRASTEFHGKYNHKLVASADDL
FT                   RATIGSRSCKIVDSRTRDRYRGENETIDPKAGHIPTAISLPYTENLDTDGFFRPPQILR
FT                   ERFASIAEQYPPESIVFYCGSGVTAAHNVLAFAHAGMGMPKLYPGSWSEWITDESRPIA
FT                   TGDE"
     MSYETLISVQ EAAKHLHDPN WVFIDCRYTL GDPEKGLRDY LQAHIPGAVY AHLDKDLSGK        60
     VIPGKTGRHP LPDLIDFDKT MSRLGVSQES QVVAYDEQTG AMAAARLWWL LKWAGHNNVA       120
     VLDGGFRAWI ANGLPVATGK ESRASTEFHG KYNHKLVASA DDLRATIGSR SCKIVDSRTR       180
     DRYRGENETI DPKAGHIPTA ISLPYTENLD TDGFFRPPQI LRERFASIAE QYPPESIVFY       240
     CGSGVTAAHN VLAFAHAGMG MPKLYPGSWS EWITDESRPI ATGDE                       285
//

If you have problems or comments...

PBIL Back to PBIL home page