(data stored in ACNUC7421 zone)

EMBL: CP001825.PE305

CP001825.PE305       Location/Qualifiers
FT   CDS             complement(328305..329228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0307"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification glutaminyl transferase-like protein"
FT                   /note="KEGG: sus:Acid_3927 glutathione synthase/ribosomal
FT                   protein S6 modification glutaminyl transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41229"
FT                   /db_xref="GOA:D1CE73"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE73"
FT                   /inference="similar to AA sequence:KEGG:Acid_3927"
FT                   /protein_id="ACZ41229.1"
FT                   /translation="MEKLRVGLLVGREKSLVSALLQEITSNYSHVDVGIARLGAVELGE
FT                   DCRYSVIVDRLSHVVPFYKAYLKHALVSGVYVINNPFVSSSDDKFHQVSLAHKLGLLTP
FT                   KTVLLPNHYFLENYSPSRELVSHPLPVDWYEVAEEVGLPCILKDAEKGEWSELHICHSV
FT                   DELMENYRHTSTRTVMVQELIDWDLFVRCLVIGEEVIPMYFDFQKKRYLPGSQGIPNEL
FT                   EESIMSDSSKIVKELGYDINLVEWAVYEDKAFLIDCFNPIPDIDPDAMEESDFKWAIKA
FT                   LAELLNQLTIKIANGEAIYRNPKLGS"
     MEKLRVGLLV GREKSLVSAL LQEITSNYSH VDVGIARLGA VELGEDCRYS VIVDRLSHVV        60
     PFYKAYLKHA LVSGVYVINN PFVSSSDDKF HQVSLAHKLG LLTPKTVLLP NHYFLENYSP       120
     SRELVSHPLP VDWYEVAEEV GLPCILKDAE KGEWSELHIC HSVDELMENY RHTSTRTVMV       180
     QELIDWDLFV RCLVIGEEVI PMYFDFQKKR YLPGSQGIPN ELEESIMSDS SKIVKELGYD       240
     INLVEWAVYE DKAFLIDCFN PIPDIDPDAM EESDFKWAIK ALAELLNQLT IKIANGEAIY       300
     RNPKLGS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page