(data stored in ACNUC7421 zone)

EMBL: CP001825.PE307

CP001825.PE307       Location/Qualifiers
FT   CDS             complement(332211..334508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0309"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: smd:Smed_5555 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41231"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE75"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ41231.1"
FT                   /translation="MHQKHGISRRKFLRLSAMAAGGVVLAACGGSTATNTPSASQPAAS
FT                   PTMGASPQPSTPGASPTAAMSPQPSAPSASPTAAASPSASATPGTSSGVPNVPYIATPV
FT                   TYQGEYKEAPSLAELVKAGKLPPVEQRLPKNPYVVPHKWVQQGKYGGKIEMLNSSSDDW
FT                   GTTHFIQESMYGHSPLRYLNDGLTIGPGLAESWESNEDATVWTFHFREGLKWSDGHPWT
FT                   VDDILFWWEDMVLNDEIPEGPPDDMRSGKGTIGKMKKIDDYTLQLIFDAPAPVTPERLA
FT                   AWVNRGIGPTWMAPKHYAKQFHKKYNPNVKKNWTEDFAFPWGKAVDFTANPDCPTMTGW
FT                   KLKEYKKGQYSIWERNPYYWCIDKWGNQLPYIDNLIMRNILDPEVLKLKFTQGAADFVH
FT                   GGFEPISPADYALLKQSEQKGDYQMIFWDSGSGTGSIFFFNHDYPDAKMRELIRNPKFK
FT                   QALSHAYNREAVRKLVYLDTGEVTTGTLSPKGVNFNINDEGRKLYEQWRDSYLEYNPDK
FT                   AKQILDEIGVVDKDGDGWREMPDGSKLVVYLDYQADTPQGGEHMRKNEQLAADWKAVGI
FT                   NAKLNPIPPTGWDDRWNSGKLMSTTTWEVGDNSILIYPGWVVPVEPAHWAPLHGAFFQV
FT                   IGTPKQNQQKNINPWKRNPPRIGPFDKEFFEPVKTLWDLYNKARVEVDRMKRISLEWQI
FT                   MKLHIEQGPFFLGVVANWPRVELVKNGLKNVPRREDLTLHGWVNPWIHPTPAVYDPETW
FT                   YWENPEQHQMQS"
     MHQKHGISRR KFLRLSAMAA GGVVLAACGG STATNTPSAS QPAASPTMGA SPQPSTPGAS        60
     PTAAMSPQPS APSASPTAAA SPSASATPGT SSGVPNVPYI ATPVTYQGEY KEAPSLAELV       120
     KAGKLPPVEQ RLPKNPYVVP HKWVQQGKYG GKIEMLNSSS DDWGTTHFIQ ESMYGHSPLR       180
     YLNDGLTIGP GLAESWESNE DATVWTFHFR EGLKWSDGHP WTVDDILFWW EDMVLNDEIP       240
     EGPPDDMRSG KGTIGKMKKI DDYTLQLIFD APAPVTPERL AAWVNRGIGP TWMAPKHYAK       300
     QFHKKYNPNV KKNWTEDFAF PWGKAVDFTA NPDCPTMTGW KLKEYKKGQY SIWERNPYYW       360
     CIDKWGNQLP YIDNLIMRNI LDPEVLKLKF TQGAADFVHG GFEPISPADY ALLKQSEQKG       420
     DYQMIFWDSG SGTGSIFFFN HDYPDAKMRE LIRNPKFKQA LSHAYNREAV RKLVYLDTGE       480
     VTTGTLSPKG VNFNINDEGR KLYEQWRDSY LEYNPDKAKQ ILDEIGVVDK DGDGWREMPD       540
     GSKLVVYLDY QADTPQGGEH MRKNEQLAAD WKAVGINAKL NPIPPTGWDD RWNSGKLMST       600
     TTWEVGDNSI LIYPGWVVPV EPAHWAPLHG AFFQVIGTPK QNQQKNINPW KRNPPRIGPF       660
     DKEFFEPVKT LWDLYNKARV EVDRMKRISL EWQIMKLHIE QGPFFLGVVA NWPRVELVKN       720
     GLKNVPRRED LTLHGWVNPW IHPTPAVYDP ETWYWENPEQ HQMQS                       765
//

If you have problems or comments...

PBIL Back to PBIL home page