(data stored in ACNUC7421 zone)

EMBL: CP001825.PE31

CP001825.PE31        Location/Qualifiers
FT   CDS             complement(32238..34319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU04320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40955"
FT                   /db_xref="GOA:D1CDE9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE9"
FT                   /inference="similar to AA sequence:KEGG:BSU04320"
FT                   /protein_id="ACZ40955.1"
FT                   /translation="MTNGHDPSSELDVKEVRRGRHPGDRYVRVQHTPGFQKVGRGYISV
FT                   TPRATEPKTFVGKALRSVRRFLIGSPIETAREVHERLTKIKALAILGSDNISSSSYATE
FT                   EIMRILLLGGISALSLTLPITLAVICVLIIVVISYQQTIRAYPHGASAYIVASNELGKL
FT                   PGLTAAASLLNDYVLTVSVSIAAGVAALGSAAPFFLGSSAGDFFYNHRVLVSIVLIMII
FT                   MIGNLRGVREAGTIFAAPTYIYIISILGLLAYGFYRFASGDLPEYNPPPGWVEEWQHRS
FT                   LGALSILLILRAFASGSVGLSGTEAISDGVPAFKPPEWKNARITLIFMAGTFGILFLGI
FT                   SFLSGQLHIIPAPEEQETVLSQLARTLVGTGPYYLLVQAATAVVLVLAANTAFSDFPRL
FT                   AYFLARDGYMPHQFLHRGDRLAFSVGIISLSVIASLLLIIFGGSVTALIPLYTVGVFVA
FT                   FTLSQSGMVAHWRRQRGKGWRVKAAVNGVGATITGIVAVIVAVTKFSSGVPLFNIGSFT
FT                   VHAGSWIVLVLVPLMILMLMSIRSHYERAQRELQPEIPINPSDIKHTIIVPVASLNKVA
FT                   LQSLAYAKSISPNVTAIHVVENQEEAEEFRKEWEKFGSPCSLVIMESPYRSLVGPILAY
FT                   IDAVDRKRPDDTITVVLPEFVPKHWWERLLHNQTALRLKAALLFRPGTVVINVPYHLK"
     MTNGHDPSSE LDVKEVRRGR HPGDRYVRVQ HTPGFQKVGR GYISVTPRAT EPKTFVGKAL        60
     RSVRRFLIGS PIETAREVHE RLTKIKALAI LGSDNISSSS YATEEIMRIL LLGGISALSL       120
     TLPITLAVIC VLIIVVISYQ QTIRAYPHGA SAYIVASNEL GKLPGLTAAA SLLNDYVLTV       180
     SVSIAAGVAA LGSAAPFFLG SSAGDFFYNH RVLVSIVLIM IIMIGNLRGV REAGTIFAAP       240
     TYIYIISILG LLAYGFYRFA SGDLPEYNPP PGWVEEWQHR SLGALSILLI LRAFASGSVG       300
     LSGTEAISDG VPAFKPPEWK NARITLIFMA GTFGILFLGI SFLSGQLHII PAPEEQETVL       360
     SQLARTLVGT GPYYLLVQAA TAVVLVLAAN TAFSDFPRLA YFLARDGYMP HQFLHRGDRL       420
     AFSVGIISLS VIASLLLIIF GGSVTALIPL YTVGVFVAFT LSQSGMVAHW RRQRGKGWRV       480
     KAAVNGVGAT ITGIVAVIVA VTKFSSGVPL FNIGSFTVHA GSWIVLVLVP LMILMLMSIR       540
     SHYERAQREL QPEIPINPSD IKHTIIVPVA SLNKVALQSL AYAKSISPNV TAIHVVENQE       600
     EAEEFRKEWE KFGSPCSLVI MESPYRSLVG PILAYIDAVD RKRPDDTITV VLPEFVPKHW       660
     WERLLHNQTA LRLKAALLFR PGTVVINVPY HLK                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page