(data stored in ACNUC7421 zone)

EMBL: CP001825.PE310

CP001825.PE310       Location/Qualifiers
FT   CDS             complement(335861..336499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0312"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dds:Ddes_0597 tRNA guanosine-2'-O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41234"
FT                   /db_xref="GOA:D1CE78"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE78"
FT                   /inference="protein motif:PRIAM:2.1.1.34"
FT                   /protein_id="ACZ41234.1"
FT                   /translation="MNTTRKITERRLNRMIQVLKRRQPDLTVVLENVHDPHNVSAVLRS
FT                   CDAVGVLAVHLVYTIEEFPDLSKNVSGSALKWLEIIKHKDIQDCYDTLRSQGMTIYTTY
FT                   LADPQRSHDLYSLDLTKPTALVFGNEQRGVSEEASRLADGNFVIPMMGMVQSLNISVAC
FT                   AVTLYEALRQRRAAGHYDHPKLSREEISTRLHNWLQREKRSIEELQKLI"
     MNTTRKITER RLNRMIQVLK RRQPDLTVVL ENVHDPHNVS AVLRSCDAVG VLAVHLVYTI        60
     EEFPDLSKNV SGSALKWLEI IKHKDIQDCY DTLRSQGMTI YTTYLADPQR SHDLYSLDLT       120
     KPTALVFGNE QRGVSEEASR LADGNFVIPM MGMVQSLNIS VACAVTLYEA LRQRRAAGHY       180
     DHPKLSREEI STRLHNWLQR EKRSIEELQK LI                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page