(data stored in ACNUC7421 zone)

EMBL: CP001825.PE314

CP001825.PE314       Location/Qualifiers
FT   CDS             339789..340637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0316"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: lysine biosynthesis enzyme LysX; alpha-L-
FT                   glutamate ligase, RimK family; PFAM: RimK domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; KEGG: afw:Anae109_2113 alpha-L-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41238"
FT                   /db_xref="GOA:D1CE82"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE82"
FT                   /inference="protein motif:TFAM:TIGR02144"
FT                   /protein_id="ACZ41238.1"
FT                   /translation="MKVGVLLSRVRAEEKLIFEEFDARGIDVERIYDPELVLDIESPIN
FT                   GYDVILERAINHSRAVSALRLFNDWGIPTVNTYEVATICGNKLETSAALARCGVPTPRT
FT                   LIAFTPESALKAIESIGYPVVLKPLIGSWGRLISLVNDRYAAEALLEHKEILGSYHHSI
FT                   FYIQEYVEKPGRDIRAFVVGDKTIAAIYRYSDHWITNTARGGQASNCPVTDEINEISVA
FT                   AAKAVGGGVVAIDLVESPEGLKVLEVNYTMEFRNSIQPTGVNIPAYIVDYVIARGEGAP
FT                   P"
     MKVGVLLSRV RAEEKLIFEE FDARGIDVER IYDPELVLDI ESPINGYDVI LERAINHSRA        60
     VSALRLFNDW GIPTVNTYEV ATICGNKLET SAALARCGVP TPRTLIAFTP ESALKAIESI       120
     GYPVVLKPLI GSWGRLISLV NDRYAAEALL EHKEILGSYH HSIFYIQEYV EKPGRDIRAF       180
     VVGDKTIAAI YRYSDHWITN TARGGQASNC PVTDEINEIS VAAAKAVGGG VVAIDLVESP       240
     EGLKVLEVNY TMEFRNSIQP TGVNIPAYIV DYVIARGEGA PP                          282
//

If you have problems or comments...

PBIL Back to PBIL home page