(data stored in ACNUC7421 zone)

EMBL: CP001825.PE316

CP001825.PE316       Location/Qualifiers
FT   CDS             341686..342552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0318"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: lysine biosynthesis enzyme LysX; alpha-L-
FT                   glutamate ligase, RimK family; PFAM: RimK domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   phosphoribosylglycinamide synthetase; KEGG: ade:Adeh_1691
FT                   SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41240"
FT                   /db_xref="GOA:D1CE84"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE84"
FT                   /inference="protein motif:TFAM:TIGR02144"
FT                   /protein_id="ACZ41240.1"
FT                   /translation="MKIGVLLSRIRIEEKLIFKAAERLGVDIVRIDDRDLIFDLGKKDF
FT                   PEVDIVLDRGLVHSRAEYTLRILESWGIPTVNSYKATITCDNKFLTNMALIEHGVPTLR
FT                   TMLAYTPESAIEAIERLGYPVVLKPNTGSWGRLLAKINDRDAAEAVLEHKEILGSYHHS
FT                   IFYIQEYVQKPGRDIRAFVIGDSVIAASYRQSDHWITNTARGGISAPCPITPEIEDLAL
FT                   RAANAVGAEIAGVDIIETPEGYKVIEINVGAEFHGLIETTDRDIPGEIISYLVSKAHKS
FT                   TVEPVAS"
     MKIGVLLSRI RIEEKLIFKA AERLGVDIVR IDDRDLIFDL GKKDFPEVDI VLDRGLVHSR        60
     AEYTLRILES WGIPTVNSYK ATITCDNKFL TNMALIEHGV PTLRTMLAYT PESAIEAIER       120
     LGYPVVLKPN TGSWGRLLAK INDRDAAEAV LEHKEILGSY HHSIFYIQEY VQKPGRDIRA       180
     FVIGDSVIAA SYRQSDHWIT NTARGGISAP CPITPEIEDL ALRAANAVGA EIAGVDIIET       240
     PEGYKVIEIN VGAEFHGLIE TTDRDIPGEI ISYLVSKAHK STVEPVAS                    288
//

If you have problems or comments...

PBIL Back to PBIL home page