(data stored in ACNUC7421 zone)

EMBL: CP001825.PE320

CP001825.PE320       Location/Qualifiers
FT   CDS             345653..346723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0322"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; KEGG: jan:Jann_1468
FT                   oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41244"
FT                   /db_xref="GOA:D1CE88"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE88"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41244.1"
FT                   /translation="MGGVPEEFQVDYKPSFPADYSPGIGIIGCGGIVKNAHLPAYKKYG
FT                   LRVVGVYDVLPQATEGVIETFGVERVYNSLEDLLADPAIEVVDIATHPAERFELINKAL
FT                   DAGKHVLSQKPLALTLSEAKQLVSKAEHKRLKLAVNQNGRWAPPWRVATLLIQKGVIGD
FT                   VLSVTHLYDINYSWVTGTNFDLIKHFAIYDYSIHWVDITRCWMEGKVPNLVRAREYRTP
FT                   VQPQDSLTPWGMWIDFEYPDGYSAFIRGIGCSQTSQEGHYFWIHGQEGTIRGSVLGSDY
FT                   VELEKDGSYHKYELEGQWFPDGFAGSMAELLSSVREDREPYNSASHNLLSLQMVLAACK
FT                   SAESSGKPVRLEEVEN"
     MGGVPEEFQV DYKPSFPADY SPGIGIIGCG GIVKNAHLPA YKKYGLRVVG VYDVLPQATE        60
     GVIETFGVER VYNSLEDLLA DPAIEVVDIA THPAERFELI NKALDAGKHV LSQKPLALTL       120
     SEAKQLVSKA EHKRLKLAVN QNGRWAPPWR VATLLIQKGV IGDVLSVTHL YDINYSWVTG       180
     TNFDLIKHFA IYDYSIHWVD ITRCWMEGKV PNLVRAREYR TPVQPQDSLT PWGMWIDFEY       240
     PDGYSAFIRG IGCSQTSQEG HYFWIHGQEG TIRGSVLGSD YVELEKDGSY HKYELEGQWF       300
     PDGFAGSMAE LLSSVREDRE PYNSASHNLL SLQMVLAACK SAESSGKPVR LEEVEN           356
//

If you have problems or comments...

PBIL Back to PBIL home page