(data stored in ACNUC7421 zone)

EMBL: CP001825.PE322

CP001825.PE322       Location/Qualifiers
FT   CDS             348346..349557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0324"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: sfu:Sfum_0061 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41246"
FT                   /db_xref="GOA:D1CE90"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE90"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACZ41246.1"
FT                   /translation="MEKIKKVVLAYSGGLDTSVILAWIKENYGAEVIAFTADVGQGEEV
FT                   EEAKQKALATGASKAYALDLREEFVRDFVFPVIRAAAVYENQYLMGTSIARPLIARELV
FT                   RIAREEGADAIAHGATGKGNDQVRFELTAYALQPDIKVIAPWREWSFKGRTDLINYAKE
FT                   KGIPVPVTPERPYSIDANLFHISYEGGVLEDPWVAPPKGMWRLTRDPEDAPDVPEEIEI
FT                   EFEAGNPVAVNGQRMGPLELLQCLNQIAGKHGVGRVDIVENRFVGMKSRGCYETPGGTL
FT                   LHIAHRAVESITLDREVMHLRDQLIPQYAEMVYNGFWYAPERIALQKFMDDIQQRVSGV
FT                   ARLKLYKGNAYVTGRKSDASLYDHKTVTFEEDEVYNQADAGGFIRLQALRLRTHAAKRL
FT                   GPGE"
     MEKIKKVVLA YSGGLDTSVI LAWIKENYGA EVIAFTADVG QGEEVEEAKQ KALATGASKA        60
     YALDLREEFV RDFVFPVIRA AAVYENQYLM GTSIARPLIA RELVRIAREE GADAIAHGAT       120
     GKGNDQVRFE LTAYALQPDI KVIAPWREWS FKGRTDLINY AKEKGIPVPV TPERPYSIDA       180
     NLFHISYEGG VLEDPWVAPP KGMWRLTRDP EDAPDVPEEI EIEFEAGNPV AVNGQRMGPL       240
     ELLQCLNQIA GKHGVGRVDI VENRFVGMKS RGCYETPGGT LLHIAHRAVE SITLDREVMH       300
     LRDQLIPQYA EMVYNGFWYA PERIALQKFM DDIQQRVSGV ARLKLYKGNA YVTGRKSDAS       360
     LYDHKTVTFE EDEVYNQADA GGFIRLQALR LRTHAAKRLG PGE                         403
//

If you have problems or comments...

PBIL Back to PBIL home page