(data stored in ACNUC7421 zone)

EMBL: CP001825.PE324

CP001825.PE324       Location/Qualifiers
FT   CDS             complement(350720..351097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_01146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE92"
FT                   /inference="similar to AA sequence:KEGG:KPN_01146"
FT                   /protein_id="ACZ41248.1"
FT                   /translation="MAKDIVLAIDNSSETLTQICEAAGRAGINLEGGCCFFCEGQGVFH
FT                   ALVEDIEGFKRVIKEAGFKIREERDVLLIDIEDRPGALGEVLRELIEAGLKVDLLYLAT
FT                   RTRVAIGTNDHARATATLLGI"
     MAKDIVLAID NSSETLTQIC EAAGRAGINL EGGCCFFCEG QGVFHALVED IEGFKRVIKE        60
     AGFKIREERD VLLIDIEDRP GALGEVLREL IEAGLKVDLL YLATRTRVAI GTNDHARATA       120
     TLLGI                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page