(data stored in ACNUC7421 zone)

EMBL: CP001825.PE325

CP001825.PE325       Location/Qualifiers
FT   CDS             complement(351114..353309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0327"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: rce:RC1_0515 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41249"
FT                   /db_xref="GOA:D1CE93"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE93"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACZ41249.1"
FT                   /translation="MQIEGACRIEDLINGTCYDPHSILGMHPVERNGRRCIELRVWVPG
FT                   AIKVSALDYKTNEEILPLERVHEAGFFIGTFPTRTEVFPYRLRISTAHHTWVQEDPYRF
FT                   LPTIGELDLYYIGEGTHRKLYEVLGAHLREIDGVKGVSFAVWAPNARGVSVIGDFNGWD
FT                   KRRYPMRVLGSSGVWEIFLPGVQVGEKYKYAINGADGIEREKADPLAFYSELRPRTASI
FT                   IYDLSGYKWKDREWMLRRLENNPYKKPMNIYEVHLGSWKRHPDGSWLSYRELADELVPY
FT                   VKRMGFNYVEFMPLLEHPYDGSWGYQVTGFYSATSRFGTPDDLRYLIDRCHQAGIGVII
FT                   DWVPAHFAVDEHGLCRFDGTYLYEHEDIRRRFQPDWGTFSFNYGRNEVRNFLTASALFW
FT                   VKEFHVDGLRVDGVSSMLYLDYSRGPGEWTPNKYGGRENLEAIDFLREMNSLVYAEGEG
FT                   AITIAEESTAWPGVSRPVYLGGLGFGFKWNMGWMHDTLEYFRKDPIYRKYHHNDLTFSM
FT                   VYAYNENFILSLSHDEVVHGKGSLVNKMPGDEWQQFANLRLLFAYQWAHPGKKLIFMGD
FT                   EFGQRSEWNHDWQLDWWVLQFGYHQGVQRLLQDLNRLYLHEPALYRLDHDPKGFTWLDY
FT                   SDWENSVISFARWSGDGNNHIVCAFNFTPVPRYNYRIPAPHLGKYREVLNTDAQIYGGS
FT                   GIGNMGEVSSEVVMHNGHPYSVAITLPPLGAVFFKPM"
     MQIEGACRIE DLINGTCYDP HSILGMHPVE RNGRRCIELR VWVPGAIKVS ALDYKTNEEI        60
     LPLERVHEAG FFIGTFPTRT EVFPYRLRIS TAHHTWVQED PYRFLPTIGE LDLYYIGEGT       120
     HRKLYEVLGA HLREIDGVKG VSFAVWAPNA RGVSVIGDFN GWDKRRYPMR VLGSSGVWEI       180
     FLPGVQVGEK YKYAINGADG IEREKADPLA FYSELRPRTA SIIYDLSGYK WKDREWMLRR       240
     LENNPYKKPM NIYEVHLGSW KRHPDGSWLS YRELADELVP YVKRMGFNYV EFMPLLEHPY       300
     DGSWGYQVTG FYSATSRFGT PDDLRYLIDR CHQAGIGVII DWVPAHFAVD EHGLCRFDGT       360
     YLYEHEDIRR RFQPDWGTFS FNYGRNEVRN FLTASALFWV KEFHVDGLRV DGVSSMLYLD       420
     YSRGPGEWTP NKYGGRENLE AIDFLREMNS LVYAEGEGAI TIAEESTAWP GVSRPVYLGG       480
     LGFGFKWNMG WMHDTLEYFR KDPIYRKYHH NDLTFSMVYA YNENFILSLS HDEVVHGKGS       540
     LVNKMPGDEW QQFANLRLLF AYQWAHPGKK LIFMGDEFGQ RSEWNHDWQL DWWVLQFGYH       600
     QGVQRLLQDL NRLYLHEPAL YRLDHDPKGF TWLDYSDWEN SVISFARWSG DGNNHIVCAF       660
     NFTPVPRYNY RIPAPHLGKY REVLNTDAQI YGGSGIGNMG EVSSEVVMHN GHPYSVAITL       720
     PPLGAVFFKP M                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page