(data stored in ACNUC7421 zone)

EMBL: CP001825.PE326

CP001825.PE326       Location/Qualifiers
FT   CDS             complement(353340..355472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0328"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: tgr:Tgr7_0567 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41250"
FT                   /db_xref="GOA:D1CE94"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE94"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ACZ41250.1"
FT                   /translation="MNFTFCPGKPYPLGATWDGSGVNFALFSPGAEKVELCIFNNPFEE
FT                   KESVRIPVTNKTNYIWHVYLPEARPGLLYGYRVYGPYDPARGLRFNHNKLLIDPYAKAI
FT                   AGDIKWSDDVFGYRITGHDDQDLIASETDSSPYVPKSVVVDTSFTWGDDKRPNIPWKDT
FT                   IIYELHVKGFTQLHPGLPENLRGTYAGLAHHEIIKYLKDLGVTAVELLPVHHFVRDRYL
FT                   VEKGLTNYWGYNTIGFFAPDSAYSSSGFMGQQVHEFKTMVRKLHKAGIEVILDVVYNHT
FT                   GEGNHFGPTLSFKGMANDRYYRLSPDSPRFYIDYTGTGNTLDTTEPYSLRLIMDSLRYW
FT                   IQEMHVDGFRFDLAATLGREAHHFDKFGSFLDIISQDPVISQVKLIAEPWDLGEGGYQL
FT                   GNFPEGWAEWNDRYRDNIRRFWRGDPGQVRELGWRLSGSSDIFASGGRGPNASINYVTS
FT                   HDGFTMRDLVSYNSKHNEANGEGNKDGTDNNLSWNCGFEGETDNQAVLSLRRRQIRNFL
FT                   TTLLVSQGTPMILHGDEVGRTQRGNNNAYCQDNETTWQPWDLEEWQRELLEWTKQVIAF
FT                   RKAHPVLRRGEYYKGQIIEGYGTKDLTWLRPDGREMTEEDWLNQEIRAFGMLLSGASAL
FT                   ECVDDNILVIFNASKRNITFYLPQPPSGLRWQLVLDTSNPRYQETLNRRVAKNYRLAPT
FT                   SMAIFKYPIQSPRTES"
     MNFTFCPGKP YPLGATWDGS GVNFALFSPG AEKVELCIFN NPFEEKESVR IPVTNKTNYI        60
     WHVYLPEARP GLLYGYRVYG PYDPARGLRF NHNKLLIDPY AKAIAGDIKW SDDVFGYRIT       120
     GHDDQDLIAS ETDSSPYVPK SVVVDTSFTW GDDKRPNIPW KDTIIYELHV KGFTQLHPGL       180
     PENLRGTYAG LAHHEIIKYL KDLGVTAVEL LPVHHFVRDR YLVEKGLTNY WGYNTIGFFA       240
     PDSAYSSSGF MGQQVHEFKT MVRKLHKAGI EVILDVVYNH TGEGNHFGPT LSFKGMANDR       300
     YYRLSPDSPR FYIDYTGTGN TLDTTEPYSL RLIMDSLRYW IQEMHVDGFR FDLAATLGRE       360
     AHHFDKFGSF LDIISQDPVI SQVKLIAEPW DLGEGGYQLG NFPEGWAEWN DRYRDNIRRF       420
     WRGDPGQVRE LGWRLSGSSD IFASGGRGPN ASINYVTSHD GFTMRDLVSY NSKHNEANGE       480
     GNKDGTDNNL SWNCGFEGET DNQAVLSLRR RQIRNFLTTL LVSQGTPMIL HGDEVGRTQR       540
     GNNNAYCQDN ETTWQPWDLE EWQRELLEWT KQVIAFRKAH PVLRRGEYYK GQIIEGYGTK       600
     DLTWLRPDGR EMTEEDWLNQ EIRAFGMLLS GASALECVDD NILVIFNASK RNITFYLPQP       660
     PSGLRWQLVL DTSNPRYQET LNRRVAKNYR LAPTSMAIFK YPIQSPRTES                  710
//

If you have problems or comments...

PBIL Back to PBIL home page