(data stored in ACNUC7421 zone)

EMBL: CP001825.PE327

CP001825.PE327       Location/Qualifiers
FT   CDS             complement(355469..356926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0329"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mch:Mchl_2940 trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41251"
FT                   /db_xref="GOA:D1CE95"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE95"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ41251.1"
FT                   /translation="MNNKLYISNKYNNLVEALHDALERASLDLQLPAYLESNRWFGAHT
FT                   RHLQSARFERWVEVPNSGGACLCVVTAIDASNNLTDYLLYLRPAEPEEEQTEIADGMQF
FT                   EDARQALLRLLTDDQSLSGFRLDAVAEVVTTPRCEGEGRTLQGEQSNTSVILDESCIMK
FT                   LYRKLEQGRNPEIELGRYLSNLRFDKTPSLLAFLKLSSSDGYDVDALVLHEYVPNQGDC
FT                   WSWALQKARLFLENVEQDSEAGAWLDQETETLQGASNIGSTLAEFHSLLARADIEGLQP
FT                   EQASQQDFDNWVESVQNEANNALEALNRVQYPDESLKNLVAEATSLQPDPPSQLGLKTR
FT                   IHGDLHLGQLLVGKDRFLIIDLEGEPAKPLFERNSLESPLVDVAGMLRSWNYVAMSLSK
FT                   QYPEKKTLLSIWENLVSNQFLRSYIDAADSSDTKFLPQDDQSTRQLLDLFKLRKALYEL
FT                   RYELDYRPDWVDIPAVSIKNLLESNLR"
     MNNKLYISNK YNNLVEALHD ALERASLDLQ LPAYLESNRW FGAHTRHLQS ARFERWVEVP        60
     NSGGACLCVV TAIDASNNLT DYLLYLRPAE PEEEQTEIAD GMQFEDARQA LLRLLTDDQS       120
     LSGFRLDAVA EVVTTPRCEG EGRTLQGEQS NTSVILDESC IMKLYRKLEQ GRNPEIELGR       180
     YLSNLRFDKT PSLLAFLKLS SSDGYDVDAL VLHEYVPNQG DCWSWALQKA RLFLENVEQD       240
     SEAGAWLDQE TETLQGASNI GSTLAEFHSL LARADIEGLQ PEQASQQDFD NWVESVQNEA       300
     NNALEALNRV QYPDESLKNL VAEATSLQPD PPSQLGLKTR IHGDLHLGQL LVGKDRFLII       360
     DLEGEPAKPL FERNSLESPL VDVAGMLRSW NYVAMSLSKQ YPEKKTLLSI WENLVSNQFL       420
     RSYIDAADSS DTKFLPQDDQ STRQLLDLFK LRKALYELRY ELDYRPDWVD IPAVSIKNLL       480
     ESNLR                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page