(data stored in ACNUC7421 zone)

EMBL: CP001825.PE329

CP001825.PE329       Location/Qualifiers
FT   CDS             complement(358585..360543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0331"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha amylase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41253"
FT                   /db_xref="GOA:D1CE97"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE97"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACZ41253.1"
FT                   /translation="MADQQPDPFYRISIVSVRPQIDCGRFPIKRIVGDRLRVTADIIKE
FT                   GHDTLGAEVRYRRQGSEEWESVPMSYSYDDDEWSAEIPIEFIGMLEYTVAAWTEVFISW
FT                   THELSRKVAAGRDVSSELLEGLELIRQAEARAVGEPKVLLAGYINRLQEASTQREKVDL
FT                   ALTPELAQLVSSHEAREDLTLYNKWLRVIVDREKARFGAWYEMFPRSQTDDPHKHGTFR
FT                   TAMKRLEAIKDMGFDVLYLPPIHPIGFTNRKGRNNALVAQPGDPGSPWAIGNQYGGHDA
FT                   VNPELGTIEDFDAFVREAQNLGIEVALDLAIQCSPDHPYVREHPEWFRKRPDGTIKYAE
FT                   NPPKKYEDIVALDMWCEDFLSLWNELKRVVLFWIEHGIRIFRVDNPHTKPVAFWEWLIS
FT                   EIKREHPDVIFLSEAFTRPKKLQLLAKIGFSQSYTYFTWRNSRWEIEQFMHELLHTEQV
FT                   EFLRPNFFANTPDILTEYLQKGGRPAFKIRLALAATLSPTYGIYSGFELIENVPLHPGS
FT                   EEYLNSEKYEIRVRDWNAPGNIIPYIKTINQARKQNRALQLYTNLTFHYPDNPNIIAYS
FT                   KISEDGSNRILVIANLDPFNWHECTVHLNGEALHIAPWDTYTVHDLITDAYYQWHGTAN
FT                   YVRLDPNYEPVHLFRIE"
     MADQQPDPFY RISIVSVRPQ IDCGRFPIKR IVGDRLRVTA DIIKEGHDTL GAEVRYRRQG        60
     SEEWESVPMS YSYDDDEWSA EIPIEFIGML EYTVAAWTEV FISWTHELSR KVAAGRDVSS       120
     ELLEGLELIR QAEARAVGEP KVLLAGYINR LQEASTQREK VDLALTPELA QLVSSHEARE       180
     DLTLYNKWLR VIVDREKARF GAWYEMFPRS QTDDPHKHGT FRTAMKRLEA IKDMGFDVLY       240
     LPPIHPIGFT NRKGRNNALV AQPGDPGSPW AIGNQYGGHD AVNPELGTIE DFDAFVREAQ       300
     NLGIEVALDL AIQCSPDHPY VREHPEWFRK RPDGTIKYAE NPPKKYEDIV ALDMWCEDFL       360
     SLWNELKRVV LFWIEHGIRI FRVDNPHTKP VAFWEWLISE IKREHPDVIF LSEAFTRPKK       420
     LQLLAKIGFS QSYTYFTWRN SRWEIEQFMH ELLHTEQVEF LRPNFFANTP DILTEYLQKG       480
     GRPAFKIRLA LAATLSPTYG IYSGFELIEN VPLHPGSEEY LNSEKYEIRV RDWNAPGNII       540
     PYIKTINQAR KQNRALQLYT NLTFHYPDNP NIIAYSKISE DGSNRILVIA NLDPFNWHEC       600
     TVHLNGEALH IAPWDTYTVH DLITDAYYQW HGTANYVRLD PNYEPVHLFR IE               652
//

If you have problems or comments...

PBIL Back to PBIL home page