(data stored in ACNUC7421 zone)

EMBL: CP001825.PE33

CP001825.PE33        Location/Qualifiers
FT   CDS             34982..35800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40957"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40957.1"
FT                   /translation="MESKYNFYHNKDTRTISKMPYKMISNNLSSYLEIGPSSFVSLVGA
FT                   GGKTTTMFRLAHELSDRGLRVITTTTTAIQMPSKNQTPLVLTREEIEQKADYLSEALEK
FT                   YRHVTIVGTIARKDKLLGVDFDFLQRVKDIADSVIAEADGARHKLIKAPAEHEPAVPPY
FT                   TTHFVAIASLKALGMPLSEACHRPEEGQKLACMDPSLPLTVEAFAKILGSPLGILKGKP
FT                   EVIRSYLLLTALSQDNKLEAEEIARRVVSTNRNGFDLIIGVDKEGGLVVL"
     MESKYNFYHN KDTRTISKMP YKMISNNLSS YLEIGPSSFV SLVGAGGKTT TMFRLAHELS        60
     DRGLRVITTT TTAIQMPSKN QTPLVLTREE IEQKADYLSE ALEKYRHVTI VGTIARKDKL       120
     LGVDFDFLQR VKDIADSVIA EADGARHKLI KAPAEHEPAV PPYTTHFVAI ASLKALGMPL       180
     SEACHRPEEG QKLACMDPSL PLTVEAFAKI LGSPLGILKG KPEVIRSYLL LTALSQDNKL       240
     EAEEIARRVV STNRNGFDLI IGVDKEGGLV VL                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page