(data stored in ACNUC7421 zone)

EMBL: CP001825.PE331

CP001825.PE331       Location/Qualifiers
FT   CDS             complement(362004..364841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0333"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: bha:BH2206 alpha-ketoglutarate decarboxylase;
FT                   TIGRFAM: 2-oxoglutarate dehydrogenase, E1 subunit; PFAM:
FT                   Transketolase central region; dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41255"
FT                   /db_xref="GOA:D1CE99"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE99"
FT                   /inference="protein motif:TFAM:TIGR00239"
FT                   /protein_id="ACZ41255.1"
FT                   /translation="MWGKNDKLYGLNAGLVAELYLRYLADPSSVDPSTRAYFDRVGNPF
FT                   PEELEELVTQAELPTEIDVLKIVGAARLARLTREYGHMAAQLDPLGTPPPGDPELELDT
FT                   HGLTEADLEKLPASVVGGPLAQTSRNALEAYRKLRDIYCGSIGYDFDQVQDSKERDWLR
FT                   DMVESRRFAIGDDPEFDRKLLERLSEVETFERFLHRYFPGQKWFSIEGLDMLIPMLDEI
FT                   ISRAAESGVREVVIGIAHRGRLNVMAHILEQPYEKIIAEFKHGLEHTKGTSNTDVGVDS
FT                   WTGDVKYHLGATLNLKTNLGCTIPITLVPNPSHLEHVNPVVEGRARAAQEDRSLPGPPR
FT                   QDERASLAILIHGDAAFPGQGIVAETLNLSRLPGYRTGGTIHIIANNQLGFTTEPSEGR
FT                   STTYAGDLAKGFEIPTVHVNADDPHACILTARLAETYRETFRKDFMIDLIGYRRYGHNE
FT                   SDEPSFTQPLMYEKIRKHPTVREIFAQKLIQRGIVSTEEVQAFVSKVEGKLRRAMQAEV
FT                   EDGRSPESEMELLEPEKDHFLQETKVSRELIAEINESLLSLPEGFEVHPKLWRTLARRR
FT                   DALERGEIDWGHAETLAFATILMNGTPIRISGQDTERGTFSQRHMVLHDVKTGQRYIPL
FT                   QAIPQARASFAIYNSPLSENAVLGFEYGYSTHAPETLVLWEAQYGDFVNGAQVMIDQFI
FT                   VSGQAKWRQKSGLVLLLPHGYEGQGPEHSSARIERFLQLAANDNIRIVYPSNAAQYFHL
FT                   LRRQAASLKSSPKPLVVFTPKSLLRHPLAMASVEDLVDGRFQKVIDDPRSDDIAPRVNR
FT                   IILCSGKIYVDLVSSKEYREANHVAIARVEELYPFPAREILQVVSRYSAAKEVVWVQEE
FT                   PRNMGAWNYIALRLRKILDPDINLGYIGRPDRASPAEGSVTLHNVQQSRIIKAAFGEAP
FT                   DISISGIRETVRHGS"
     MWGKNDKLYG LNAGLVAELY LRYLADPSSV DPSTRAYFDR VGNPFPEELE ELVTQAELPT        60
     EIDVLKIVGA ARLARLTREY GHMAAQLDPL GTPPPGDPEL ELDTHGLTEA DLEKLPASVV       120
     GGPLAQTSRN ALEAYRKLRD IYCGSIGYDF DQVQDSKERD WLRDMVESRR FAIGDDPEFD       180
     RKLLERLSEV ETFERFLHRY FPGQKWFSIE GLDMLIPMLD EIISRAAESG VREVVIGIAH       240
     RGRLNVMAHI LEQPYEKIIA EFKHGLEHTK GTSNTDVGVD SWTGDVKYHL GATLNLKTNL       300
     GCTIPITLVP NPSHLEHVNP VVEGRARAAQ EDRSLPGPPR QDERASLAIL IHGDAAFPGQ       360
     GIVAETLNLS RLPGYRTGGT IHIIANNQLG FTTEPSEGRS TTYAGDLAKG FEIPTVHVNA       420
     DDPHACILTA RLAETYRETF RKDFMIDLIG YRRYGHNESD EPSFTQPLMY EKIRKHPTVR       480
     EIFAQKLIQR GIVSTEEVQA FVSKVEGKLR RAMQAEVEDG RSPESEMELL EPEKDHFLQE       540
     TKVSRELIAE INESLLSLPE GFEVHPKLWR TLARRRDALE RGEIDWGHAE TLAFATILMN       600
     GTPIRISGQD TERGTFSQRH MVLHDVKTGQ RYIPLQAIPQ ARASFAIYNS PLSENAVLGF       660
     EYGYSTHAPE TLVLWEAQYG DFVNGAQVMI DQFIVSGQAK WRQKSGLVLL LPHGYEGQGP       720
     EHSSARIERF LQLAANDNIR IVYPSNAAQY FHLLRRQAAS LKSSPKPLVV FTPKSLLRHP       780
     LAMASVEDLV DGRFQKVIDD PRSDDIAPRV NRIILCSGKI YVDLVSSKEY REANHVAIAR       840
     VEELYPFPAR EILQVVSRYS AAKEVVWVQE EPRNMGAWNY IALRLRKILD PDINLGYIGR       900
     PDRASPAEGS VTLHNVQQSR IIKAAFGEAP DISISGIRET VRHGS                       945
//

If you have problems or comments...

PBIL Back to PBIL home page