(data stored in ACNUC7421 zone)

EMBL: CP001825.PE333

CP001825.PE333       Location/Qualifiers
FT   CDS             366905..367957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0335"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: glo:Glov_1075 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41257"
FT                   /db_xref="GOA:D1CEA1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA1"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACZ41257.1"
FT                   /translation="METITKPGSSPGRKVNRIGLERTDYRGGVSTLCAGCGHDSISSQI
FT                   MTAAFELSLKPEQIIKLSGIGCSSKSPAYFLGRSHGFNAIHGRMPAVATGATLANRKLL
FT                   AIGVSGDGDTGSIGIGHFKHMVRRNIPLVYIIENNGVYGLTKGQFSATADIGQKLKHAG
FT                   INELPPMDLCMEAIIAGCGFVARSFAGDAKQVRQLLKAAMSFKGTAVIDIISPCVTFNN
FT                   AEDSTKSYPYGKANEEPLHEIGFVPKYEEIVVDYDPGTVKEVELHDGSVIQLRKLDRDY
FT                   DPTNKVEALRLLEEAQANREFITGLIYFNEDRPSFPEVMRLPEKPLAELQEEDLRPPKE
FT                   ALEAIMSGLM"
     METITKPGSS PGRKVNRIGL ERTDYRGGVS TLCAGCGHDS ISSQIMTAAF ELSLKPEQII        60
     KLSGIGCSSK SPAYFLGRSH GFNAIHGRMP AVATGATLAN RKLLAIGVSG DGDTGSIGIG       120
     HFKHMVRRNI PLVYIIENNG VYGLTKGQFS ATADIGQKLK HAGINELPPM DLCMEAIIAG       180
     CGFVARSFAG DAKQVRQLLK AAMSFKGTAV IDIISPCVTF NNAEDSTKSY PYGKANEEPL       240
     HEIGFVPKYE EIVVDYDPGT VKEVELHDGS VIQLRKLDRD YDPTNKVEAL RLLEEAQANR       300
     EFITGLIYFN EDRPSFPEVM RLPEKPLAEL QEEDLRPPKE ALEAIMSGLM                  350
//

If you have problems or comments...

PBIL Back to PBIL home page