(data stored in ACNUC7421 zone)

EMBL: CP001825.PE334

CP001825.PE334       Location/Qualifiers
FT   CDS             complement(367958..368752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0336"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: swi:Swit_2098 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41258"
FT                   /db_xref="GOA:D1CEA2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA2"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACZ41258.1"
FT                   /translation="MKLGIVFSPASNWQEIFQAALLADKLGLDSVGFWDHYHSMKPEWG
FT                   YVCGWASYGAIACATERVKLVPMVICNLNYALGVMAKETSMLALISDGRFELGIGAGDY
FT                   PEEYAAWNLPYPDAEFRIALLRENMLALREVWQGKQVTFNGQKVKLQDATCAPPPSKPP
FT                   RIIVGAGKSKKLIRSALEYADEINIYADQELVRYTKRVISNSNKPIGLSVYLHFDWDQW
FT                   PQDISQEIAKWKQVGIDRLFINVGYEWPLQEKVREIASAIID"
     MKLGIVFSPA SNWQEIFQAA LLADKLGLDS VGFWDHYHSM KPEWGYVCGW ASYGAIACAT        60
     ERVKLVPMVI CNLNYALGVM AKETSMLALI SDGRFELGIG AGDYPEEYAA WNLPYPDAEF       120
     RIALLRENML ALREVWQGKQ VTFNGQKVKL QDATCAPPPS KPPRIIVGAG KSKKLIRSAL       180
     EYADEINIYA DQELVRYTKR VISNSNKPIG LSVYLHFDWD QWPQDISQEI AKWKQVGIDR       240
     LFINVGYEWP LQEKVREIAS AIID                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page