(data stored in ACNUC7421 zone)

EMBL: CP001825.PE335

CP001825.PE335       Location/Qualifiers
FT   CDS             complement(368775..369161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0337"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: bba:Bd3645 putative
FT                   methylated-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41259"
FT                   /db_xref="GOA:D1CEA3"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA3"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACZ41259.1"
FT                   /translation="MSTPKEAKSFKEIVWKIVSSIPKGKVMTYGQIAALAGYPGSAQVV
FT                   GWILHYTPPELNIPCQRVVNRFGGLAAGYGWGGVYSHKKDLEKDGVEVREDFTVDLQKY
FT                   QWFPPQELVDEWLSFKLERLSQDS"
     MSTPKEAKSF KEIVWKIVSS IPKGKVMTYG QIAALAGYPG SAQVVGWILH YTPPELNIPC        60
     QRVVNRFGGL AAGYGWGGVY SHKKDLEKDG VEVREDFTVD LQKYQWFPPQ ELVDEWLSFK       120
     LERLSQDS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page