(data stored in ACNUC7421 zone)

EMBL: CP001825.PE336

CP001825.PE336       Location/Qualifiers
FT   CDS             complement(369164..370093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0338"
FT                   /product="ADP-ribosyl-(dinitrogen reductase) hydrolase"
FT                   /EC_number="3.2.2.24"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   rpd:RPD_2408 ADP-ribosyl-(dinitrogen reductase) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41260"
FT                   /db_xref="GOA:D1CEA4"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA4"
FT                   /inference="protein motif:PRIAM:3.2.2.24"
FT                   /protein_id="ACZ41260.1"
FT                   /translation="MSTDQGDLKLLSKARGTLIAAACGDALGGPLELMGKNEIRRNLGQ
FT                   VRDFIGGGWLSLSPGEVTDDTQMMLEVARSIATLGRVDPQDITTRLVEWMNSNPKDIDH
FT                   TVFESLSLIRDGTPIYEASKLVIEREGFMNGSRGNGCLIPCVPIALLLYKREQALVKQT
FT                   RSVASITHANPVCQWAAVALNMMISELLRGRFEQVVVRVADKVPQPEISEMLRSIEKKS
FT                   EDDLDNSGDVLATLESAIWAFGNTSSLEDAIIKAANLGGDADTRAAVTGALAGAHYGIE
FT                   SIPQRWLERLEPAQELIVLAEQIVRTSR"
     MSTDQGDLKL LSKARGTLIA AACGDALGGP LELMGKNEIR RNLGQVRDFI GGGWLSLSPG        60
     EVTDDTQMML EVARSIATLG RVDPQDITTR LVEWMNSNPK DIDHTVFESL SLIRDGTPIY       120
     EASKLVIERE GFMNGSRGNG CLIPCVPIAL LLYKREQALV KQTRSVASIT HANPVCQWAA       180
     VALNMMISEL LRGRFEQVVV RVADKVPQPE ISEMLRSIEK KSEDDLDNSG DVLATLESAI       240
     WAFGNTSSLE DAIIKAANLG GDADTRAAVT GALAGAHYGI ESIPQRWLER LEPAQELIVL       300
     AEQIVRTSR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page