(data stored in ACNUC7421 zone)

EMBL: CP001825.PE34

CP001825.PE34        Location/Qualifiers
FT   CDS             complement(35801..36391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0035"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40958"
FT                   /db_xref="GOA:D1CDF2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF2"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACZ40958.1"
FT                   /translation="MKIGVLALQGDFREHEQMLHRIGIVPVEVRKPEHLYGLDGIIIPG
FT                   GESTTIGKLAVNYGLMEPLKDFAAQGKPVWGTCAGMIFLSKDVGMEQPLLGLLDVKVRR
FT                   NAFGRQLDSFEADIEMPEVSERPVHAVFIRAPIVESVGPGVQVLGKLQDGTIVAVRQGN
FT                   ILATSFHPELTQDPTMHLYFISMAKEDLVTNRS"
     MKIGVLALQG DFREHEQMLH RIGIVPVEVR KPEHLYGLDG IIIPGGESTT IGKLAVNYGL        60
     MEPLKDFAAQ GKPVWGTCAG MIFLSKDVGM EQPLLGLLDV KVRRNAFGRQ LDSFEADIEM       120
     PEVSERPVHA VFIRAPIVES VGPGVQVLGK LQDGTIVAVR QGNILATSFH PELTQDPTMH       180
     LYFISMAKED LVTNRS                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page