(data stored in ACNUC7421 zone)

EMBL: CP001825.PE340

CP001825.PE340       Location/Qualifiers
FT   CDS             complement(372116..372706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0342"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   sus:Acid_7860 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41264"
FT                   /db_xref="GOA:D1CEA8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41264.1"
FT                   /translation="MSNQPLDDQAIMERLSRGDLSAMEALYDCYSRAVYSMILRIVQDQ
FT                   QVAEELTQETFFRAWKQAKSFSNDRGKCASWLMSIAHNIAIDEIRRCKARPKSIRSEDS
FT                   SNYLMNLPDSSLEDPDEIIMGGIRRNIVLEALRELPENQRKVLEMSYFGGLTQSEIADK
FT                   VGEPLGTIKTRMRLALQHLRRNLIEKGIKPEQL"
     MSNQPLDDQA IMERLSRGDL SAMEALYDCY SRAVYSMILR IVQDQQVAEE LTQETFFRAW        60
     KQAKSFSNDR GKCASWLMSI AHNIAIDEIR RCKARPKSIR SEDSSNYLMN LPDSSLEDPD       120
     EIIMGGIRRN IVLEALRELP ENQRKVLEMS YFGGLTQSEI ADKVGEPLGT IKTRMRLALQ       180
     HLRRNLIEKG IKPEQL                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page