(data stored in ACNUC7421 zone)

EMBL: CP001825.PE342

CP001825.PE342       Location/Qualifiers
FT   CDS             373227..373886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0344"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: smd:Smed_3882
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41266"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ41266.1"
FT                   /translation="MPETKILLVRHADVHNPDQIVYGRLPRFRLSKLGEAQAEATAEFL
FT                   SKEDVKYIYTSPMLRARQTAKAIAKYHPDAKLRISKLLAEINTSWQGIPWSQIGANANL
FT                   YEPIKDPENETIEDVAKRMLRIIRTLVRRHPGETVICVSHADPIKIAWVALEGKELTFE
FT                   NIRKPPYPDRASVTTITFNDDHVVSIKYENPAISVRVTPEQESEKKPSRKKVPVGV"
     MPETKILLVR HADVHNPDQI VYGRLPRFRL SKLGEAQAEA TAEFLSKEDV KYIYTSPMLR        60
     ARQTAKAIAK YHPDAKLRIS KLLAEINTSW QGIPWSQIGA NANLYEPIKD PENETIEDVA       120
     KRMLRIIRTL VRRHPGETVI CVSHADPIKI AWVALEGKEL TFENIRKPPY PDRASVTTIT       180
     FNDDHVVSIK YENPAISVRV TPEQESEKKP SRKKVPVGV                              219
//

If you have problems or comments...

PBIL Back to PBIL home page