(data stored in ACNUC7421 zone)

EMBL: CP001825.PE343

CP001825.PE343       Location/Qualifiers
FT   CDS             complement(373917..376262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0345"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: bca:BCE_0672
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41267"
FT                   /db_xref="GOA:D1CEB1"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB1"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ACZ41267.1"
FT                   /translation="MGSTEHWSQPTETIPTIKPKASSQRRQSRNGSVLRTYLPLVGISV
FT                   FLCAFLLLAVSVGYSYYYRSKIYPNVYSLGINLGGMTPEQARQALNAKAMEYVRTPLVL
FT                   TQGEHTWKITPAELGLQPNVDPAVQQAYKYGRDGNIFHQFAERIPIGRRTVRIQYVLDK
FT                   SKIDNYVNNKLAPQIARPATDSKLTVSGDGTILASKEVDGQKLNTSMAIQQIYSALVNL
FT                   RKGDIALPVVTVKANITQSTWRDRQNLVLKLSKPVTLRFENRSWTITSDEIEQAIVAES
FT                   GAEGVVGKIEPSKLMPILANINKDIALPPEPAKLEIKGNQVALTPEQPGRRVDYSATLS
FT                   AIYAALQSSGETDLATKEIEPIVTTSVLENARSQLEKLLASPLKLHFKDQSWEIPTSTL
FT                   ADWTSIDIDKANRTSSVKLDPNKVNEFVDNLASEINQNPINGELTWRGKLVVLRESQDG
FT                   QDLDTEKTKDLIAQAAFSDDRDVDLPVKVTKPKIPTDNLAALGIKESIGWGSSEFTGSP
FT                   PERVHNIQTAAGYLNNTVVAPGETFSFEKAIGEISVERGYQEGLTIVADQTVPGIGGGV
FT                   CQVSTTMFRAAFWAGLPIVERHQHSYLVPYYQLDGDPPGFDAAVYFPYKDLKWKNTTGH
FT                   YILIEAKWTDTKLTITLYGTDPGYEVTRGKPVITNIVPPLPDKTIYDPTLPPGTKEQVD
FT                   WAHEGMDVTITRTVTKNGKVVLQDSFFSRYKPWGNIYRVGPPKKEPSKKEPPKKETKNK
FT                   NKESENKDKQQKKDVNNSKDSTKKIEQR"
     MGSTEHWSQP TETIPTIKPK ASSQRRQSRN GSVLRTYLPL VGISVFLCAF LLLAVSVGYS        60
     YYYRSKIYPN VYSLGINLGG MTPEQARQAL NAKAMEYVRT PLVLTQGEHT WKITPAELGL       120
     QPNVDPAVQQ AYKYGRDGNI FHQFAERIPI GRRTVRIQYV LDKSKIDNYV NNKLAPQIAR       180
     PATDSKLTVS GDGTILASKE VDGQKLNTSM AIQQIYSALV NLRKGDIALP VVTVKANITQ       240
     STWRDRQNLV LKLSKPVTLR FENRSWTITS DEIEQAIVAE SGAEGVVGKI EPSKLMPILA       300
     NINKDIALPP EPAKLEIKGN QVALTPEQPG RRVDYSATLS AIYAALQSSG ETDLATKEIE       360
     PIVTTSVLEN ARSQLEKLLA SPLKLHFKDQ SWEIPTSTLA DWTSIDIDKA NRTSSVKLDP       420
     NKVNEFVDNL ASEINQNPIN GELTWRGKLV VLRESQDGQD LDTEKTKDLI AQAAFSDDRD       480
     VDLPVKVTKP KIPTDNLAAL GIKESIGWGS SEFTGSPPER VHNIQTAAGY LNNTVVAPGE       540
     TFSFEKAIGE ISVERGYQEG LTIVADQTVP GIGGGVCQVS TTMFRAAFWA GLPIVERHQH       600
     SYLVPYYQLD GDPPGFDAAV YFPYKDLKWK NTTGHYILIE AKWTDTKLTI TLYGTDPGYE       660
     VTRGKPVITN IVPPLPDKTI YDPTLPPGTK EQVDWAHEGM DVTITRTVTK NGKVVLQDSF       720
     FSRYKPWGNI YRVGPPKKEP SKKEPPKKET KNKNKESENK DKQQKKDVNN SKDSTKKIEQ       780
     R                                                                       781
//

If you have problems or comments...

PBIL Back to PBIL home page