(data stored in ACNUC7421 zone)

EMBL: CP001825.PE345

CP001825.PE345       Location/Qualifiers
FT   CDS             376936..377385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0347"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: dvm:DvMF_1241
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41269"
FT                   /db_xref="GOA:D1CEB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB3"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACZ41269.1"
FT                   /translation="MTIQDKRTSELVDLLRNAGMRVTPQRLEIVSALVHGSHPSAEEIY
FT                   EQVSAKLPTTSLATVYNTLEALKSLGQVLEVRPPQGGIRYDVLRPYGHSHLVCKRCGRV
FT                   EDAPQQILENGEVSLKVPDIGWSDLEIRLDLEGICPYCREVGADG"
     MTIQDKRTSE LVDLLRNAGM RVTPQRLEIV SALVHGSHPS AEEIYEQVSA KLPTTSLATV        60
     YNTLEALKSL GQVLEVRPPQ GGIRYDVLRP YGHSHLVCKR CGRVEDAPQQ ILENGEVSLK       120
     VPDIGWSDLE IRLDLEGICP YCREVGADG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page