(data stored in ACNUC7421 zone)

EMBL: CP001825.PE349

CP001825.PE349       Location/Qualifiers
FT   CDS             380120..380941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0351"
FT                   /product="peptidase M55 D-aminopeptidase"
FT                   /note="PFAM: peptidase M55 D-aminopeptidase; KEGG:
FT                   bsu:BSU12920 D-alanyl-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41273"
FT                   /db_xref="GOA:D1CEB7"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB7"
FT                   /inference="protein motif:PFAM:PF04951"
FT                   /protein_id="ACZ41273.1"
FT                   /translation="MRVYISADMEGISGVVHPSQIDPNGSDYLRGRRLQTGDVNAAIEG
FT                   ALQAGASEVIVNDSHWVQRNILLEDLHPCARLISGSTKRLGMVHGVEGADLALFIGYHA
FT                   KHGTPYAIADHTWSSSCVDDLRLNGHSIGEFALNAYICGYFGVPVVMASGDQALENEAK
FT                   ALIPGIQVAVVKLATGRWAAECLPLSESRKLIRSCAKEAVSVRNIQPLSPPSPCEVELD
FT                   LMVTEMADRAEYVPGVHRIGGRTIGFECEDIIKAFEMFRTVVNAASLFTPF"
     MRVYISADME GISGVVHPSQ IDPNGSDYLR GRRLQTGDVN AAIEGALQAG ASEVIVNDSH        60
     WVQRNILLED LHPCARLISG STKRLGMVHG VEGADLALFI GYHAKHGTPY AIADHTWSSS       120
     CVDDLRLNGH SIGEFALNAY ICGYFGVPVV MASGDQALEN EAKALIPGIQ VAVVKLATGR       180
     WAAECLPLSE SRKLIRSCAK EAVSVRNIQP LSPPSPCEVE LDLMVTEMAD RAEYVPGVHR       240
     IGGRTIGFEC EDIIKAFEMF RTVVNAASLF TPF                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page