(data stored in ACNUC7421 zone)

EMBL: CP001825.PE35

CP001825.PE35        Location/Qualifiers
FT   CDS             complement(36451..37527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0036"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: bha:BH0022 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40959"
FT                   /db_xref="GOA:D1CDF3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF3"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ACZ40959.1"
FT                   /translation="MTIYRKHFTKYNLYVATKMVIVCVITFITSIRVSYKNFSATPVFV
FT                   CAKMIYWSNPNTPYIQEAIEVEKSTELTKRGLAEMLKGGVIMDVVNAEQARIAEAAGAV
FT                   AVMALERVPADIRAQGGVARMSDPALIEEIMNAVTIPVMAKVRIGHFVEAQILEALGVD
FT                   YIDESEVLTPADEMHHIDKKKFKVPFVCGARDLGEALRRVGEGASMLRLKGEAGTGNIV
FT                   EAVRHARLIYSEVRRLSTMPEDEWMAYAKQIQAPYELVAEVARTGKLPVVNFAAGGIAT
FT                   PADAALMMQLGVDGIFVGSGIFKSSDPYKRAKAIVEATTHYNDPEVLVRVSKGLGEAMH
FT                   GIDIRTLSQEELMAPRGW"
     MTIYRKHFTK YNLYVATKMV IVCVITFITS IRVSYKNFSA TPVFVCAKMI YWSNPNTPYI        60
     QEAIEVEKST ELTKRGLAEM LKGGVIMDVV NAEQARIAEA AGAVAVMALE RVPADIRAQG       120
     GVARMSDPAL IEEIMNAVTI PVMAKVRIGH FVEAQILEAL GVDYIDESEV LTPADEMHHI       180
     DKKKFKVPFV CGARDLGEAL RRVGEGASML RLKGEAGTGN IVEAVRHARL IYSEVRRLST       240
     MPEDEWMAYA KQIQAPYELV AEVARTGKLP VVNFAAGGIA TPADAALMMQ LGVDGIFVGS       300
     GIFKSSDPYK RAKAIVEATT HYNDPEVLVR VSKGLGEAMH GIDIRTLSQE ELMAPRGW         358
//

If you have problems or comments...

PBIL Back to PBIL home page