(data stored in ACNUC7421 zone)

EMBL: CP001825.PE350

CP001825.PE350       Location/Qualifiers
FT   CDS             381028..382395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0352"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sil:SPOA0312
FT                   glutamate-1-semialdehyde 2,1- aminomutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41274"
FT                   /db_xref="GOA:D1CEB8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB8"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACZ41274.1"
FT                   /translation="MMGHLTRELSAVVDRYIQQRPRSAEIYQRAVEDLPDGVTHDKRFM
FT                   TPFPTYIQRAKGSRKWDVDGNEYVDYVMGHGALLLGHCHPEVTQAVVEQVQKFTHPGGS
FT                   HELEVEWAELVKSLIPSAEKVRFTSSGTEATHMAIRLARAYTGRKKIVKLEGHFHGWHD
FT                   GVAKAQTPPYDRKTPGIPDEISELTLVSPAKLESIEKIFSSDRDIAAIIFEPSGASYGT
FT                   VPLPEGFVQGLKDLSDRYGVLLICDEVVTGFRWSPGGVQALAGIKPDLTTLAKILAGGF
FT                   PGGAVAGRADILDLISHASDPAKRIVHQGTFNANPVSAAAGVECLKIVGSSDVCQQAAS
FT                   KAAVLRSRLNEKFEDLQIPGCAYGESSICHIIIGEEVPNRVRGDLQRPDLPEDVLRTKG
FT                   TNQQLMWLFDLAMMNEGVDLFSGSAFVSSYHTDEDIDLTIDAFVKVVSELKNEGYL"
     MMGHLTRELS AVVDRYIQQR PRSAEIYQRA VEDLPDGVTH DKRFMTPFPT YIQRAKGSRK        60
     WDVDGNEYVD YVMGHGALLL GHCHPEVTQA VVEQVQKFTH PGGSHELEVE WAELVKSLIP       120
     SAEKVRFTSS GTEATHMAIR LARAYTGRKK IVKLEGHFHG WHDGVAKAQT PPYDRKTPGI       180
     PDEISELTLV SPAKLESIEK IFSSDRDIAA IIFEPSGASY GTVPLPEGFV QGLKDLSDRY       240
     GVLLICDEVV TGFRWSPGGV QALAGIKPDL TTLAKILAGG FPGGAVAGRA DILDLISHAS       300
     DPAKRIVHQG TFNANPVSAA AGVECLKIVG SSDVCQQAAS KAAVLRSRLN EKFEDLQIPG       360
     CAYGESSICH IIIGEEVPNR VRGDLQRPDL PEDVLRTKGT NQQLMWLFDL AMMNEGVDLF       420
     SGSAFVSSYH TDEDIDLTID AFVKVVSELK NEGYL                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page