(data stored in ACNUC7421 zone)

EMBL: CP001825.PE352

CP001825.PE352       Location/Qualifiers
FT   CDS             383419..384345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0354"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: pmr:PMI3049 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41276"
FT                   /db_xref="GOA:D1CEC0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC0"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ACZ41276.1"
FT                   /translation="MTARVVVVGSSNTDMVVPVPHIPGVGETVLGGDLIIAPGGKGANQ
FT                   AVAAARLGAEVVFIGAVGSDDFGQKAIKGLNADGIDTSYVKIVDGTPSGVALIMVDPSG
FT                   NNSIAVSPGANSRLFPEDIELSSKVLQNARILLTQLEVPLDTVATALEFGKKMDCVTML
FT                   NPAPAPATGLPSDIISHVDVITPNEVEARALVGRDMPSEDLAKALLDLGVKIVILTLGE
FT                   RGALVAQQDKLVAVEPFAVSPVDTTAAGDAFSGALAVAIAEGLELIDAVRFANAAAALS
FT                   VTKMGAQPSMPTRAELETFLSRHQISG"
     MTARVVVVGS SNTDMVVPVP HIPGVGETVL GGDLIIAPGG KGANQAVAAA RLGAEVVFIG        60
     AVGSDDFGQK AIKGLNADGI DTSYVKIVDG TPSGVALIMV DPSGNNSIAV SPGANSRLFP       120
     EDIELSSKVL QNARILLTQL EVPLDTVATA LEFGKKMDCV TMLNPAPAPA TGLPSDIISH       180
     VDVITPNEVE ARALVGRDMP SEDLAKALLD LGVKIVILTL GERGALVAQQ DKLVAVEPFA       240
     VSPVDTTAAG DAFSGALAVA IAEGLELIDA VRFANAAAAL SVTKMGAQPS MPTRAELETF       300
     LSRHQISG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page