(data stored in ACNUC7421 zone)

EMBL: CP001825.PE355

CP001825.PE355       Location/Qualifiers
FT   CDS             385965..387698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0357"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Cna B domain protein; KEGG: gme:Gmet_0751
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41279"
FT                   /db_xref="GOA:D1CEC3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034084"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACZ41279.1"
FT                   /translation="MVLSSSIRRLVIVVTTSLALFFLTISQSPGYAYAASRNSDLEPRV
FT                   LTTGRILVKFRSGTDASKVLQAASIQSGIIVDRVNPLGVKVVRPRTVLAQSLGTLERLA
FT                   NHIEQNPSVIYAQPEVLLQPQDVIPNDPDYPRQWGLQRIRAPKAWEISTGSSTVKIGIV
FT                   DSGIAMNHPELKDRYAGGYDFVQHDTYPQDTDGHGTHVAGIAAATGNNGIGIAGVGWRT
FT                   KLLVARVLTAEGATDTDVAKGIIWVTDHGASVINISLGTYYDSDTLHQAIQYAQEKGVL
FT                   VVAAAGNESTNIPLYPAAYPGVIGVAATNQDDRYASFSNYGSYVDISAPGVDIYSTYPG
FT                   GYAYMSGTSMAAPFVTGAAAVIKAEFPWYSANQIWQRLKAGADDLGPKGLDTRYGYGRL
FT                   NLYRSLAVPGTLIGRVRNAKTGNVLPGVRVQLYGTPRYTYTDSQGRFVFRNIRYGAGKL
FT                   IFSKQGYAQGMRNIFIEPAATEYTGIRLAPLARLSGYVRSSSGTPLSNAVVSVTSQEGS
FT                   DLQDTTDSYGRYFIKNVPIGIVRVTASLKDYTSVTKNVSTTMGTTTSVSFTLKPLLAPG
FT                   N"
     MVLSSSIRRL VIVVTTSLAL FFLTISQSPG YAYAASRNSD LEPRVLTTGR ILVKFRSGTD        60
     ASKVLQAASI QSGIIVDRVN PLGVKVVRPR TVLAQSLGTL ERLANHIEQN PSVIYAQPEV       120
     LLQPQDVIPN DPDYPRQWGL QRIRAPKAWE ISTGSSTVKI GIVDSGIAMN HPELKDRYAG       180
     GYDFVQHDTY PQDTDGHGTH VAGIAAATGN NGIGIAGVGW RTKLLVARVL TAEGATDTDV       240
     AKGIIWVTDH GASVINISLG TYYDSDTLHQ AIQYAQEKGV LVVAAAGNES TNIPLYPAAY       300
     PGVIGVAATN QDDRYASFSN YGSYVDISAP GVDIYSTYPG GYAYMSGTSM AAPFVTGAAA       360
     VIKAEFPWYS ANQIWQRLKA GADDLGPKGL DTRYGYGRLN LYRSLAVPGT LIGRVRNAKT       420
     GNVLPGVRVQ LYGTPRYTYT DSQGRFVFRN IRYGAGKLIF SKQGYAQGMR NIFIEPAATE       480
     YTGIRLAPLA RLSGYVRSSS GTPLSNAVVS VTSQEGSDLQ DTTDSYGRYF IKNVPIGIVR       540
     VTASLKDYTS VTKNVSTTMG TTTSVSFTLK PLLAPGN                                577
//

If you have problems or comments...

PBIL Back to PBIL home page