(data stored in ACNUC7421 zone)

EMBL: CP001825.PE358

CP001825.PE358       Location/Qualifiers
FT   CDS             391301..393253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA0997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41282"
FT                   /db_xref="GOA:D1CEC6"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41282.1"
FT                   /translation="MLGVLLLISCLILGILVLYLLVPGLTFEERIFYGFDLGVILISIA
FT                   CFVSAIFFGFNLLQVCLTSLCLLIVSFVLTFWLRSQVAARIKNELQDFRSRLKLRETVW
FT                   FAEMLLVIGVFFFHLYYNSWRLYPDGWYAGHSFIWGDLPIHTGLIESFVEIRKFPPPNI
FT                   YFSGTLLSYPFMADFFSSILMILGWSLGPAFVIPGFLLGICTVAGIYLLALRISRSVFA
FT                   SLLTVVLVLLSGGMGFIVFLVEANRSGNFIHTLLNLPSYYTGLRDYAMTYPNIVLGFFL
FT                   PQRPFLLALPLGMLMLSLLYRFRLSRRPYDMLLVGLASALLPLVHPHTLVTIGIVSGYL
FT                   VVEYLVLSFLCNDKQGCYRALLSGVLFSLPVTVGMLQVLWQLGNLGATSNGGLSVQITT
FT                   RAIATENYIWYWLKNVGLFLPLAGLIFVVQGALPNRIRSFYAPFALIWFIATLVVMQPF
FT                   DCCNRKLLVYWYLVSAVVISLVLVKLILTGDIISRFLVAFLIFLLVFTGSLDLFRASIP
FT                   SQSRYLEFSNEDIAFANQVKERLPADAVYITATQVHHPITDLAGRQVVLGPPYLANDWG
FT                   LPWRPRMEDLQLIYTGSSRAQDLIRKYGARYLVIGPTERQLFRVNKQYYQERFPVVLRY
FT                   GQYTVFDVSSVYGSR"
     MLGVLLLISC LILGILVLYL LVPGLTFEER IFYGFDLGVI LISIACFVSA IFFGFNLLQV        60
     CLTSLCLLIV SFVLTFWLRS QVAARIKNEL QDFRSRLKLR ETVWFAEMLL VIGVFFFHLY       120
     YNSWRLYPDG WYAGHSFIWG DLPIHTGLIE SFVEIRKFPP PNIYFSGTLL SYPFMADFFS       180
     SILMILGWSL GPAFVIPGFL LGICTVAGIY LLALRISRSV FASLLTVVLV LLSGGMGFIV       240
     FLVEANRSGN FIHTLLNLPS YYTGLRDYAM TYPNIVLGFF LPQRPFLLAL PLGMLMLSLL       300
     YRFRLSRRPY DMLLVGLASA LLPLVHPHTL VTIGIVSGYL VVEYLVLSFL CNDKQGCYRA       360
     LLSGVLFSLP VTVGMLQVLW QLGNLGATSN GGLSVQITTR AIATENYIWY WLKNVGLFLP       420
     LAGLIFVVQG ALPNRIRSFY APFALIWFIA TLVVMQPFDC CNRKLLVYWY LVSAVVISLV       480
     LVKLILTGDI ISRFLVAFLI FLLVFTGSLD LFRASIPSQS RYLEFSNEDI AFANQVKERL       540
     PADAVYITAT QVHHPITDLA GRQVVLGPPY LANDWGLPWR PRMEDLQLIY TGSSRAQDLI       600
     RKYGARYLVI GPTERQLFRV NKQYYQERFP VVLRYGQYTV FDVSSVYGSR                  650
//

If you have problems or comments...

PBIL Back to PBIL home page