(data stored in ACNUC7421 zone)

EMBL: CP001825.PE36

CP001825.PE36        Location/Qualifiers
FT   CDS             37541..38287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0037"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="KEGG: bha:BH1486 3'-phosphoadenosine 5'-
FT                   phosphosulfate reductase; TIGRFAM: phosphoadenosine
FT                   phosphosulfate reductase; PFAM: phosphoadenosine
FT                   phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40960"
FT                   /db_xref="GOA:D1CDF4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF4"
FT                   /inference="protein motif:TFAM:TIGR00434"
FT                   /protein_id="ACZ40960.1"
FT                   /translation="MSLVDKIVEEPAKEELDRINAELEDATPQEIIKWAVDRFGDGLIL
FT                   ACSFGGISGMAILDMAVKIKPDIDVFYIDTDFLFPETHQTKEEAIKRYGIKPIAFKTKL
FT                   TPEAQAEKYGDELWKRNPDLCCHIRKVEPTREALKGRSAWITGLRRDQSSTRRNVRPVE
FT                   WDYKFGLYKINPLAYWNEREVWRYIFKHNVPYNPLHDQGYPSIGCTHCTSPVYGSEDSR
FT                   AGRWAGTGKVECGLHIKLPQTESSSQ"
     MSLVDKIVEE PAKEELDRIN AELEDATPQE IIKWAVDRFG DGLILACSFG GISGMAILDM        60
     AVKIKPDIDV FYIDTDFLFP ETHQTKEEAI KRYGIKPIAF KTKLTPEAQA EKYGDELWKR       120
     NPDLCCHIRK VEPTREALKG RSAWITGLRR DQSSTRRNVR PVEWDYKFGL YKINPLAYWN       180
     EREVWRYIFK HNVPYNPLHD QGYPSIGCTH CTSPVYGSED SRAGRWAGTG KVECGLHIKL       240
     PQTESSSQ                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page