(data stored in ACNUC7421 zone)

EMBL: CP001825.PE362

CP001825.PE362       Location/Qualifiers
FT   CDS             397199..398359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0364"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bcb:BCB4264_A5464
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41286"
FT                   /db_xref="GOA:D1CED0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACZ41286.1"
FT                   /translation="MGLSNCLALPEDYQVLRSIVRKFAEDRIRPQVLQNDREARFPAGI
FT                   IEELGQLGFMGAPINPQYGGSGSDFLSYAILIEELSRVDPSIGTIVSAHTSLTAVPLQR
FT                   WGTEEQKGKYLSLLASGKTLGAFALTEPESGTDAASIQTRASRDGDHYFLTGTKVWITN
FT                   ASHAGLFIVFARTDNRGNHKDISAFIVDRESPGLVVDPSESKLGIKAAHSCTVHLDGVK
FT                   VSARDRLGEEGQGFKIAMQSLDGGRIGIAAQAVGIGQACLEMSIQYAVQRRQFGRPIAE
FT                   FQAIQWKIADMATQVEAARLLTYRAAMLEDKGENITLAASMAKLFASEMCVSAAREAIQ
FT                   IHGSLGYSAEYPVEKFYRDSKVTEIYEGTSEAQRMVIASRLLKELQ"
     MGLSNCLALP EDYQVLRSIV RKFAEDRIRP QVLQNDREAR FPAGIIEELG QLGFMGAPIN        60
     PQYGGSGSDF LSYAILIEEL SRVDPSIGTI VSAHTSLTAV PLQRWGTEEQ KGKYLSLLAS       120
     GKTLGAFALT EPESGTDAAS IQTRASRDGD HYFLTGTKVW ITNASHAGLF IVFARTDNRG       180
     NHKDISAFIV DRESPGLVVD PSESKLGIKA AHSCTVHLDG VKVSARDRLG EEGQGFKIAM       240
     QSLDGGRIGI AAQAVGIGQA CLEMSIQYAV QRRQFGRPIA EFQAIQWKIA DMATQVEAAR       300
     LLTYRAAMLE DKGENITLAA SMAKLFASEM CVSAAREAIQ IHGSLGYSAE YPVEKFYRDS       360
     KVTEIYEGTS EAQRMVIASR LLKELQ                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page