(data stored in ACNUC7421 zone)

EMBL: CP001825.PE363

CP001825.PE363       Location/Qualifiers
FT   CDS             398490..399506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0365"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 region 4 domain protein;
FT                   KEGG: bha:BH1376 RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41287"
FT                   /db_xref="GOA:D1CED1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED1"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACZ41287.1"
FT                   /translation="MLSEIHDVPFQDPHFSHQYEDLPEEAEYDKQEEDLSEDLDDSVRM
FT                   YLREIGLVPLLTAEQEVELAKKMERGKKAQSVLDSGKYEPEQRDKLLAEVDEGERARRH
FT                   LIEANLRLVVSVAKKHMNRGLSLLDLIEEGNIGLMRATDKFDYRKGFKFSTYATWWIRQ
FT                   AVTRAIADQARTIRLPVHITETMNHLYKASRKLSQELGREPTCEELAEYMGMNPEKVRL
FT                   IMRASRHPLSLEGPVGTDGDSSLGQFIPDSTTETPVDLAIGEVLKRELSKVLNSLTEKE
FT                   RKVMVLRYGLEGSSPHTLEEVGHRLGVTRERVRQIEAKALEKLRKPGKLNHLRDFLD"
     MLSEIHDVPF QDPHFSHQYE DLPEEAEYDK QEEDLSEDLD DSVRMYLREI GLVPLLTAEQ        60
     EVELAKKMER GKKAQSVLDS GKYEPEQRDK LLAEVDEGER ARRHLIEANL RLVVSVAKKH       120
     MNRGLSLLDL IEEGNIGLMR ATDKFDYRKG FKFSTYATWW IRQAVTRAIA DQARTIRLPV       180
     HITETMNHLY KASRKLSQEL GREPTCEELA EYMGMNPEKV RLIMRASRHP LSLEGPVGTD       240
     GDSSLGQFIP DSTTETPVDL AIGEVLKREL SKVLNSLTEK ERKVMVLRYG LEGSSPHTLE       300
     EVGHRLGVTR ERVRQIEAKA LEKLRKPGKL NHLRDFLD                               338
//

If you have problems or comments...

PBIL Back to PBIL home page