(data stored in ACNUC7421 zone)

EMBL: CP001825.PE364

CP001825.PE364       Location/Qualifiers
FT   CDS             399533..400540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0366"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   mxa:MXAN_4674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41288"
FT                   /db_xref="GOA:D1CED2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED2"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACZ41288.1"
FT                   /translation="MGEPIVSEIRVISFGLGPIGSEVARVAASKSNMRLVGAVDIDPSK
FT                   VGRTVEEVTGAPSEVIVSSSLEEALQNTEADLILHTTSSFLEVVKPQIESAIEKGLSVV
FT                   STCEELSYPWRTYPGLATELDMKAKEANVRILGTGVNPGFVMDAFPLTVTTVCQKVDRI
FT                   HIERVVDAGGRRLQLQRKVGAGLTVEEFRQLVATGNVRHVGLPESAWMIIDAMGWECKD
FT                   FEESIEPIVAEREILAAIGNIQPGQVAGVRQTIRAYGRDIEKLVLDLKMYVGADEPVDH
FT                   IQIWGIPDLDLRFDGGVHGDRATASIVVNAASVLMNLPPGLRTMLDVMPLRFRS"
     MGEPIVSEIR VISFGLGPIG SEVARVAASK SNMRLVGAVD IDPSKVGRTV EEVTGAPSEV        60
     IVSSSLEEAL QNTEADLILH TTSSFLEVVK PQIESAIEKG LSVVSTCEEL SYPWRTYPGL       120
     ATELDMKAKE ANVRILGTGV NPGFVMDAFP LTVTTVCQKV DRIHIERVVD AGGRRLQLQR       180
     KVGAGLTVEE FRQLVATGNV RHVGLPESAW MIIDAMGWEC KDFEESIEPI VAEREILAAI       240
     GNIQPGQVAG VRQTIRAYGR DIEKLVLDLK MYVGADEPVD HIQIWGIPDL DLRFDGGVHG       300
     DRATASIVVN AASVLMNLPP GLRTMLDVMP LRFRS                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page