(data stored in ACNUC7421 zone)

EMBL: CP001825.PE365

CP001825.PE365       Location/Qualifiers
FT   CDS             400546..401217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41289"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41289.1"
FT                   /translation="MKHLLSGLLAILIATCWACSPLGFLTQGSGSSKVHLPTPTGFSSP
FT                   AAVVTPTTNSPASTPSVIPSATPSKVISSSIAFESKIYNYTLKLPAGWYGVSGGISSAG
FT                   VRGDVFYPRKPGVEAYITVFAEDLNPGVNLDSYVDASVNNISRIAGVRVQRLGDYRGGL
FT                   ISGQWLAWTDFSKSPEVFYIRQLVWVYGSKAWVMTLRSKDKNLSNYISVLEFMAATWRA
FT                   E"
     MKHLLSGLLA ILIATCWACS PLGFLTQGSG SSKVHLPTPT GFSSPAAVVT PTTNSPASTP        60
     SVIPSATPSK VISSSIAFES KIYNYTLKLP AGWYGVSGGI SSAGVRGDVF YPRKPGVEAY       120
     ITVFAEDLNP GVNLDSYVDA SVNNISRIAG VRVQRLGDYR GGLISGQWLA WTDFSKSPEV       180
     FYIRQLVWVY GSKAWVMTLR SKDKNLSNYI SVLEFMAATW RAE                         223
//

If you have problems or comments...

PBIL Back to PBIL home page