(data stored in ACNUC7421 zone)

EMBL: CP001825.PE366

CP001825.PE366       Location/Qualifiers
FT   CDS             complement(401236..401391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41290"
FT                   /db_xref="GOA:D1CED4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED4"
FT                   /inference="similar to AA sequence:KEGG:Msil_0116"
FT                   /protein_id="ACZ41290.1"
FT                   /translation="MSLLWLLIILLIIAILFGGWGYGRYGPYVSIGPVALIILIILILW
FT                   LTGSLT"
     MSLLWLLIIL LIIAILFGGW GYGRYGPYVS IGPVALIILI ILILWLTGSL T                 51
//

If you have problems or comments...

PBIL Back to PBIL home page