(data stored in ACNUC7421 zone)

EMBL: CP001825.PE368

CP001825.PE368       Location/Qualifiers
FT   CDS             403265..404026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0370"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bha:BH0166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41292"
FT                   /db_xref="GOA:D1CED6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACZ41292.1"
FT                   /translation="MDPYYLYIDRDSIFHRLDPRTKMLLLLVTFVLVFISLNPLYLLAI
FT                   LLLVLLAGYVAGVLVNLRRIRFVLFMITLVTIVLWSLFQQGTTPLFWIVERESVVYAVS
FT                   VAIRIDTMVIAGLIFLSITRNEDIAMALVRIGIPYRFAFVVSTALRLVPTIASTTTTIT
FT                   QAQRSRGLDLDTGGPIQRIKNYIPLLIPVFISTIRSTNIFSMALESKGFGAMPSRTYYL
FT                   QLKMVGRDFVVIFIALGLLVFIILARILGYL"
     MDPYYLYIDR DSIFHRLDPR TKMLLLLVTF VLVFISLNPL YLLAILLLVL LAGYVAGVLV        60
     NLRRIRFVLF MITLVTIVLW SLFQQGTTPL FWIVERESVV YAVSVAIRID TMVIAGLIFL       120
     SITRNEDIAM ALVRIGIPYR FAFVVSTALR LVPTIASTTT TITQAQRSRG LDLDTGGPIQ       180
     RIKNYIPLLI PVFISTIRST NIFSMALESK GFGAMPSRTY YLQLKMVGRD FVVIFIALGL       240
     LVFIILARIL GYL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page