(data stored in ACNUC7421 zone)

EMBL: CP001825.PE372

CP001825.PE372       Location/Qualifiers
FT   CDS             405908..407341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0374"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   nmu:Nmul_A0903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41296"
FT                   /db_xref="GOA:D1CEE0"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE0"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACZ41296.1"
FT                   /translation="MDLSKLEKIDEYTWTVPLKPGEKRAPVVLYGTKELLRSMDDKVLE
FT                   QITNVAKLPGIVGKAMTMPDAHWGYGFPIGGVAAFDPEEGGIISAGGVGFDISCGIRCL
FT                   RTDLSLRDLEPYAERLADELYKTIPAGVGEEGEIKLSPKELDRVLEGGAEWAVREGYGV
FT                   PEDLEYIEEHGRMEGAVPEFVSKEAKKRQKGEMGTLGSGNHYLEVQVVEKVYDQKAAEA
FT                   FGLWEGQIVVSIHCGSRGLGHQIGTDYLLSLAKAAQRLKIDLPDRELACAPITSPEGHE
FT                   YIGAMNAGINCALANRQILTHLTRQAFRKIIPGTKVETLYDVSHNTCKREKHVIDGRER
FT                   FVYIHRKGATRAYGPGHPDIPQRYRNIGQPVLIGGSMGTGSYILVGVDTSEQRALSTAS
FT                   HGAGRALSRRQALKQWSGKEIIQQLAARGIIVRAHSSRGVAEEAPDAYKNVDLVAEATE
FT                   YAGLANRVALLRPKICVKG"
     MDLSKLEKID EYTWTVPLKP GEKRAPVVLY GTKELLRSMD DKVLEQITNV AKLPGIVGKA        60
     MTMPDAHWGY GFPIGGVAAF DPEEGGIISA GGVGFDISCG IRCLRTDLSL RDLEPYAERL       120
     ADELYKTIPA GVGEEGEIKL SPKELDRVLE GGAEWAVREG YGVPEDLEYI EEHGRMEGAV       180
     PEFVSKEAKK RQKGEMGTLG SGNHYLEVQV VEKVYDQKAA EAFGLWEGQI VVSIHCGSRG       240
     LGHQIGTDYL LSLAKAAQRL KIDLPDRELA CAPITSPEGH EYIGAMNAGI NCALANRQIL       300
     THLTRQAFRK IIPGTKVETL YDVSHNTCKR EKHVIDGRER FVYIHRKGAT RAYGPGHPDI       360
     PQRYRNIGQP VLIGGSMGTG SYILVGVDTS EQRALSTASH GAGRALSRRQ ALKQWSGKEI       420
     IQQLAARGII VRAHSSRGVA EEAPDAYKNV DLVAEATEYA GLANRVALLR PKICVKG          477
//

If you have problems or comments...

PBIL Back to PBIL home page